Property Summary

NCBI Gene PubMed Count 16
PubMed Score 11.20
PubTator Score 6.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma 1.033 2.1e-02
adult high grade glioma -4.600 7.1e-09
astrocytic glioma -3.200 1.2e-03
Astrocytoma, Pilocytic -3.200 6.0e-09
atypical teratoid / rhabdoid tumor -5.100 7.2e-09
ependymoma -4.000 2.5e-03
glioblastoma -4.200 2.6e-11
group 3 medulloblastoma -1.700 1.0e-03
interstitial cystitis 1.300 8.6e-04
lung carcinoma 4.300 5.5e-54
medulloblastoma, large-cell -3.600 1.8e-05
oligodendroglioma -2.700 7.4e-03
osteosarcoma -2.791 2.2e-09
Pick disease -2.200 1.8e-02
primitive neuroectodermal tumor -2.400 2.1e-02

Gene RIF (4)

AA Sequence

MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVK      1 - 70
TVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVIL     71 - 140
VGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQ    141 - 210
NTRLKETPPPPQPNCAC                                                         211 - 227
//

Text Mined References (16)

PMID Year Title