Property Summary

NCBI Gene PubMed Count 16
PubMed Score 10.56
PubTator Score 6.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 5.45507710550767E-54
posterior fossa group A ependymoma 1511 5.67738304843249E-26
oligodendroglioma 2849 1.11323765324728E-17
osteosarcoma 7933 2.15122830078027E-9
pediatric high grade glioma 2712 3.43270807684847E-9
pilocytic astrocytoma 3086 5.3862818607258E-9
atypical teratoid / rhabdoid tumor 4369 7.164968707445E-9
sonic hedgehog group medulloblastoma 1482 1.6301446275295E-6
glioblastoma 5572 2.09660443485063E-6
medulloblastoma, large-cell 6234 1.78980485359902E-5
interstitial cystitis 2299 8.64826565978672E-4
astrocytic glioma 2241 0.00117976591383474
Pick disease 1893 0.0183395431150647
primitive neuroectodermal tumor 3031 0.0211349858791125
adrenocortical carcinoma 1427 0.0211630396322068

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -3.200 0.001
posterior fossa group A ependymoma -5.800 0.000
oligodendroglioma -2.800 0.000
glioblastoma -4.900 0.000
osteosarcoma -2.791 0.000
sonic hedgehog group medulloblastoma -3.200 0.000
atypical teratoid / rhabdoid tumor -5.100 0.000
medulloblastoma, large-cell -3.600 0.000
primitive neuroectodermal tumor -2.400 0.021
adrenocortical carcinoma 1.033 0.021
interstitial cystitis 1.300 0.001
pediatric high grade glioma -4.600 0.000
pilocytic astrocytoma -3.200 0.000
lung carcinoma 4.300 0.000
Pick disease -2.200 0.018

Synonym

Accession Q96E17
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19717423 Rab3b/3c-positive recycling vesicles are involved in and may constitute one of the recycling compartments in exogenous antigen cross-presentation.
19240061 Observational study of gene-disease association. (HuGE Navigator)
12296628 cloning, mapping, and characterization; expressed in the brain, placenta, and lung; maps to chromosome 5q13

AA Sequence

MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVK      1 - 70
TVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVIL     71 - 140
VGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQ    141 - 210
NTRLKETPPPPQPNCAC                                                         211 - 227
//

Text Mined References (16)

PMID Year Title
24891604 2014 Rab18 and a Rab18 GEF complex are required for normal ER structure.
24006491 2013 Identification and characterization of multiple novel Rab-myosin Va interactions.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19717423 2009 The GTPase Rab3b/3c-positive recycling vesicles are involved in cross-presentation in dendritic cells.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15159548 2004 Noc2 is essential in normal regulation of exocytosis in endocrine and exocrine cells.
More...