Property Summary

NCBI Gene PubMed Count 12
PubMed Score 20.02
PubTator Score 16.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma 2.484 4.3e-07
astrocytic glioma -1.100 4.2e-03
atypical teratoid/rhabdoid tumor 1.300 4.9e-04
Breast cancer 1.500 4.5e-10
ductal carcinoma in situ 1.300 3.2e-03
ependymoma -1.400 2.8e-03
interstitial cystitis -1.100 1.2e-03
invasive ductal carcinoma 2.300 3.3e-04
lung adenocarcinoma 1.200 1.1e-05
nasopharyngeal carcinoma 1.100 1.7e-04
non-small cell lung cancer 2.700 9.3e-27
oligodendroglioma -1.400 1.5e-03
osteosarcoma -1.817 1.0e-03
ovarian cancer 2.200 1.4e-08

Protein-protein Interaction (3)

Gene RIF (5)

AA Sequence

MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRG      1 - 70
EARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVE     71 - 140
DLHRNIP                                                                   141 - 147
//

Text Mined References (18)

PMID Year Title