Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.06
PubTator Score 0.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.100 1.8e-04
atypical teratoid / rhabdoid tumor -1.100 6.4e-05
Breast cancer -1.100 4.8e-13
hepatocellular carcinoma 1.100 1.0e-04
invasive ductal carcinoma -1.100 2.5e-03
medulloblastoma, large-cell -1.300 1.4e-04
osteosarcoma -1.270 6.9e-04
ovarian cancer -1.500 3.8e-07
tuberculosis and treatment for 6 months -1.300 2.7e-06

Synonym

Accession Q96E09
Symbols C9orf42

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

AA Sequence

MAQEKMELDLELPPGTGGSPAEGGGSGGGGGLRRSNSAPLIHGLSDTSPVFQAEAPSARRNSTTFPSRHG      1 - 70
LLLPASPVRMHSSRLHQIKQEEGMDLINRETVHEREVQTAMQISHSWEESFSLSDNDVEKSASPKRIDFI     71 - 140
PVSPAPSPTRGIGKQCFSPSLQSFVSSNGLPPSPIPSPTTRFTTRRSQSPINCIRPSVLGPLKRKCEMET    141 - 210
EYQPKRFFQGITNMLSSDVAQLSDPGVCVSSDTLDGNSSSAGSSCNSPAKVSTTTDSPVSPAQAASPFIP    211 - 280
LDELSSK                                                                   281 - 287
//

Text Mined References (21)

PMID Year Title