Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.06
PubTator Score 0.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.000
osteosarcoma -2.039 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
medulloblastoma, large-cell -1.300 0.000
tuberculosis and treatment for 6 months -1.300 0.000
adult high grade glioma -1.100 0.000
Breast cancer -1.100 0.000
invasive ductal carcinoma -1.100 0.002
ovarian cancer -1.500 0.000

AA Sequence

MAQEKMELDLELPPGTGGSPAEGGGSGGGGGLRRSNSAPLIHGLSDTSPVFQAEAPSARRNSTTFPSRHG      1 - 70
LLLPASPVRMHSSRLHQIKQEEGMDLINRETVHEREVQTAMQISHSWEESFSLSDNDVEKSASPKRIDFI     71 - 140
PVSPAPSPTRGIGKQCFSPSLQSFVSSNGLPPSPIPSPTTRFTTRRSQSPINCIRPSVLGPLKRKCEMET    141 - 210
EYQPKRFFQGITNMLSSDVAQLSDPGVCVSSDTLDGNSSSAGSSCNSPAKVSTTTDSPVSPAQAASPFIP    211 - 280
LDELSSK                                                                   281 - 287
//

Text Mined References (21)

PMID Year Title
27588481 2016 FAM122A, a new endogenous inhibitor of protein phosphatase 2A.
25735772 2015 14-3-3-Pred: improved methods to predict 14-3-3-binding phosphopeptides.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...