Property Summary

NCBI Gene PubMed Count 18
PubMed Score 13.24
PubTator Score 14.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Alzheimer's disease -1.200 3.0e-02
Astrocytoma, Pilocytic 1.300 9.4e-03
atypical teratoid / rhabdoid tumor -1.700 5.1e-06
gastric cancer 1.100 6.8e-03
group 3 medulloblastoma -2.900 1.6e-03
medulloblastoma, large-cell -1.400 7.1e-03
mucosa-associated lymphoid tissue lympho... 1.359 4.8e-02
non-inflammatory breast cancer -1.400 4.2e-10
osteosarcoma -1.454 1.7e-02
pancreatic cancer 1.900 2.5e-04
pancreatic carcinoma 1.900 2.5e-04
Pick disease -1.300 2.1e-04
progressive supranuclear palsy -1.600 1.3e-02
psoriasis -1.500 2.7e-31
subependymal giant cell astrocytoma -2.688 3.4e-03

Gene RIF (12)

AA Sequence

MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYMAAALLEFFIT      1 - 70
LAFLFLYATQYYQRFDRINWPCLLQGHGQSGGPHPLDLLSHSAKVQPQPWPGLTPPGWHTPAAVPWVPAP     71 - 140
APGFWSWLLWFICFHSLGSSDFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSIFAYDAFKIYR    141 - 210
TEMAPGASQGDQQ                                                             211 - 223
//

Text Mined References (19)

PMID Year Title