Property Summary

NCBI Gene PubMed Count 17
PubMed Score 11.14
PubTator Score 14.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (11)

PMID Text
25387568 results indicate that CMTM5 is down-regulated in prostate cancer and exhibit tumor suppressor activities in androgen-independent prostate cancer cells
24721428 In the OSCC cell lines CAL27 and GNM, the ectopic expression of CMTM5-v1 strongly inhibited cell proliferation and migration and induced apoptosis.
21841490 The reduced expression of CMTM5 correlates significantly with poorly differentiated ovarian cancer and high preoperative CA125 level.
21168207 Data suggest that CMTM5 may be involved in the pathomechanism of myeloid leukemias.
20721248 HER2 was up regulated in prostate cancer epithelium while CMTM5 was down regulated. Overexpression of CMTM5 in PC3 cells could lower the HER2 and Cyclin D1 protein level.
20416169 The expression level of cmtm5 gene is abnormally lower in the bone marrow cells from the multiple myeloma patients, and are associated with ISS stages.
20356458 CMTM5-v1 might be secreted via a different vesicle-mediated secretory pathway, which will be helpful for the studies of vesicle-mediated secretion and MARVEL domain-containing proteins.
19577543 CMTM5 may play a role in the pancreatic cancer.
19124004 These findings verify that CMTM5-v1 inhibits the growth of CC cell lines via inducing apoptosis.
17908965 CMTM5 exhibits tumor suppressor activities, but with frequent epigenetic inactivation in carcinoma cell lines
More...

AA Sequence

MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYMAAALLEFFIT      1 - 70
LAFLFLYATQYYQRFDRINWPCLLQGHGQSGGPHPLDLLSHSAKVQPQPWPGLTPPGWHTPAAVPWVPAP     71 - 140
APGFWSWLLWFICFHSLGSSDFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSIFAYDAFKIYR    141 - 210
TEMAPGASQGDQQ                                                             211 - 223
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25387568 2015 CMTM5 is reduced in prostate cancer and inhibits cancer cell growth in vitro and in vivo.
24721428 2014 CMTM5 exhibits tumor suppressor activity through promoter methylation in oral squamous cell carcinoma.
21841490 2011 Reduced CMTM5 expression correlates with carcinogenesis in human epithelial ovarian cancer.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21168207 2011 Aberrant expression of CKLF-like MARVEL transmembrane member 5 (CMTM5) by promoter methylation in myeloid leukemia.
20721248 2010 [CMTM5 inhibits the tumor cell behavior of prostate cancer by downregulation of HER2].
20416169 2010 [Abnormally lower expression of cmtm5 gene in bone marrow cells from patients with multiple myeloma].
20356458 2010 CMTM5-v1, a four-transmembrane protein, presents a secreted form released via a vesicle-mediated secretory pathway.
19577543 2009 CMTM5 induces apoptosis of pancreatic cancer cells and has synergistic effects with TNF-alpha.
More...