Property Summary

NCBI Gene PubMed Count 16
Grant Count 33
R01 Count 13
Funding $3,476,148.01
PubMed Score 13.47
PubTator Score 13.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
osteosarcoma 7,933
ovarian cancer 8,484

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.483 0.022
ovarian cancer -1.400 0.000

Gene RIF (11)

PMID Text
26280083 data show that MTBP aggravates the invasion and metastasis of HCC by promoting the MDM2-mediated degradation of E-cadherin.
25759210 Overexpression of MTBP resulted in the suppression of the migratory and metastatic potential of Hepatocellular carcinoma cells, while its downregulation increased the migration.
24866769 MTBP significantly contributes to breast cancer survival and is a potential novel therapeutic target in Triple-negative breast cancer .
24786788 MTBP associated with MYC at promoters and increased MYC-mediated transcription, proliferation, neoplastic transformation, and tumor development.
23704573 MTBP acts with Treslin/TICRR to integrate signals from cell cycle and DNA damage response pathways to control the initiation of DNA replication in human cells.
22370640 MTBP also inhibited ACTN4-mediated F-actin bundling.
21692053 results represent the first examination of MTBP expression in human tissues and provide evidence for a p53 status-dependent role for MTBP in suppressing disease progression in squamous cell carcinoma of the head and neck patients
21274008 MTBP has an important role in recruiting and/or retaining the Mad1/Mad2 complex at the kinetochores during prometaphase, but its degradation is required for silencing the mitotic checkpoint.
15632057 Data suggest that MTBP differentially regulates the activity of MDM2 towards two of its most critical targets (itself and p53) and in doing so significantly contributes to MDM2-dependent p53 homeostasis in unstressed cells.
15632057 MTBP contributes to MDM2 activity and through this to negative regulation of p53
More...

AA Sequence

MDRYLLLVIWGEGKFPSAASREAEHGPEVSSGEGTENQPDFTAANVYHLLKRSISASINPEDSTFPACSV      1 - 70
GGIPGSKKWFFAVQAIYGFYQFCSSDWQEIHFDTEKDKIEDVLQTNIEECLGAVECFEEEDSNSRESLSL     71 - 140
ADLYEEAAENLHQLSDKLPAPGRAMVDIILLLSDKDPPKLKDYLPTVGALKHLREWYSAKITIAGNHCEI    141 - 210
NCQKIAEYLSANVVSLEDLRNVIDSKELWRGKIQIWERKFGFEISFPEFCLKGVTLKNFSTSNLNTDFLA    211 - 280
KKIIPSKDKNILPKVFHYYGPALEFVQMIKLSDLPSCYMSDIEFELGLTNSTKQNSVLLLEQISSLCSKV    281 - 350
GALFVLPCTISNILIPPPNQLSSRKWKEYIAKKPKTISVPDVEVKGECSSYYLLLQGNGNRRCKATLIHS    351 - 420
ANQINGSFALNLIHGKMKTKTEEAKLSFPFDLLSLPHFSGEQIVQREKQLANVQVLALEECLKRRKLAKQ    421 - 490
PETVSVAELKSLLVLTRKHFLDYFDAVIPKMILRKMDKIKTFNILNDFSPVEPNSSSLMETNPLEWPERH    491 - 560
VLQNLETFEKTKQKMRTGSLPHSSEQLLGHKEGPRDSITLLDAKELLKYFTSDGLPIGDLQPLPIQKGEK    561 - 630
TFVLTPELSPGKLQVLPFEKASVCHYHGIEYCLDDRKALERDGGFSELQSRLIRYETQTTCTRESFPVPT    631 - 700
VLSPLPSPVVSSDPGSVPDGEVLQNELRTEVSRLKRRSKDLNCLYPRKRLVKSESSESLLSQTTGNSNHY    701 - 770
HHHVTSRKPQTERSLPVTCPLVPIPSCETPKLATKTSSGQKSMHESKTSRQIKESRSQKHTRILKEVVTE    771 - 840
TLKKHSITETHECFTACSQRLFEISKFYLKDLKTSRGLFEEMKKTANNNAVQVIDWVLEKTSKK          841 - 904
//

Text Mined References (23)

PMID Year Title
26280083 2015 MTBP Promotes the Invasion and Metastasis of Hepatocellular Carcinoma by Enhancing the MDM2-Mediated Degradation of E-Cadherin.
25759210 2015 MTBP inhibits migration and metastasis of hepatocellular carcinoma.
25317112 2014 Epidemiological and genome-wide association study of gastritis or gastric ulcer in korean populations.
24866769 2014 MTBP is overexpressed in triple-negative breast cancer and contributes to its growth and survival.
24786788 2014 Oncogenic protein MTBP interacts with MYC to promote tumorigenesis.
23704573 2013 Identification of a heteromeric complex that promotes DNA replication origin firing in human cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22684342 2012 MDM2 binding protein, a novel metastasis suppressor.
22370640 2013 MTBP suppresses cell migration and filopodia formation by inhibiting ACTN4.
21692053 2011 Loss of MTBP expression is associated with reduced survival in a biomarker-defined subset of patients with squamous cell carcinoma of the head and neck.
More...