Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.33
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
nasopharyngeal carcinoma 1058 5.4e-10
posterior fossa group B ependymoma 416 1.8e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (2)

Disease log2 FC p
nasopharyngeal carcinoma -1.900 5.4e-10
posterior fossa group B ependymoma 1.700 1.8e-06

AA Sequence

MALDILAMAPLYQAPAINRIGPKTDPSKRPADPLKPLVLSRTKLTTIEAKRIMSILDEAIYKVELVTLLS      1 - 70
YVASNREDMEGMLGEDVMRAVREHEDLCQVLLENVRCLKEKERQLQEQKEAEEEGWLRDRLLSIELQKSS     71 - 140
LSPLMQQIKDSTKNVLRLLLSNPQAARLLQMQTQGRSAEAQNFIDSLIELRGFLFEKLLTSPMEARDKAQ    141 - 210
FLQDISRQNSNNQQIIDTLEKELAERMKNRNAEVEKENFVIQELKNHLHQVLKFSENSLVRTKQEAEKQQ    211 - 280
KADFRASQARVAKIQQEILQLQSQFYNLVMENREAEQALRKKKYKVETEIENWIQKYDTEMGEKQEELED    281 - 350
LDAVHREEKISLEELRRRHKVLVGEFAQIREEREINSKKRMEAEQEMVRMVRAATLIQALWKGYLVRSLL    351 - 420
RSKKKRGKGKAKDKEKGKQKGKEKGKGKK                                             421 - 449
//

Text Mined References (8)

PMID Year Title