Property Summary

NCBI Gene PubMed Count 18
PubMed Score 49.70
PubTator Score 13.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.007 0.003
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.500 0.000
group 4 medulloblastoma -1.300 0.000
adult high grade glioma -1.400 0.000
ovarian cancer 1.600 0.000

Synonym

Accession Q96DX7 D3DR14 Q96QY2 Q9UGK0
Symbols AN3
MC7
DIPB
HSA249128

Gene

PANTHER Protein Class (2)

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (7)

PMID Text
26394807 Variants in TRIM44 Cause Aniridia by Impairing PAX6 Expression
25345539 Trim44 promotes non-small cell lung cancer development through activation of NF-kappaB signaling via upregulating CXCL16 and MMP9 expression.
23460740 rim44 functions as a positive regulator of the virus-triggered immune response by enhancing the stability of VISA.
22862969 Overexpression of the TRIM44 protein was significantly correlated with an advanced type of macroscopic appearance.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19358823 terf interacts with TRIM44;TRIM44 inhibited ubiquitination of terf, and thus stabilized the protein.
18854154 Knockdown of tripartite motif containing 44 (TRIM44) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQKFLSHHLAEYVHGSQAWTPP      1 - 70
ADGEGAGKEEAEVKVEQEREIESEAGEESESEEESESEEESETEEESEDESDEESEEDSEEEMEDEQESE     71 - 140
AEEDNQEEGESEAEGETEAESEFDPEIEMEAERVAKRKCPDHGLDLSTYCQEDRQLICVLCPVIGAHQGH    141 - 210
QLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHL    211 - 280
VDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT          281 - 344
//

Text Mined References (19)

PMID Year Title
26394807 2015 Variants in TRIM44 Cause Aniridia by Impairing PAX6 Expression.
25416956 2014 A proteome-scale map of the human interactome network.
25345539 2015 Trim44 facilitates the migration and invasion of human lung cancer cells via the NF-?B signaling pathway.
23460740 2013 Novel function of Trim44 promotes an antiviral response by stabilizing VISA.
22862969 2012 Overexpression of TRIM44 contributes to malignant outcome in gastric carcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19875103 2010 Genomewide association study of movement-related adverse antipsychotic effects.
19358823 2009 TRIM44 interacts with and stabilizes terf, a TRIM ubiquitin E3 ligase.
17577209 2007 The interactome of the histone gene regulatory factor HiNF-P suggests novel cell cycle related roles in transcriptional control and RNA processing.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
More...