Property Summary

NCBI Gene PubMed Count 20
PubMed Score 7.19
PubTator Score 11.43

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
psoriasis -1.900 0.000
osteosarcoma -1.889 0.000
nasopharyngeal carcinoma 1.400 0.002

Gene RIF (7)

PMID Text
25654263 Molecular docking yielded a structural model consistent with all of the data that suggested the N-terminal residues of ASB9(1-252) may lie in one CK active site. This model was corroborated by enzymatic activity assays and mutational analysis.
23837592 ASB9 is unstable alone but forms a stable ternary complex with EloBC that binds with high affinity to the Cullin 5 N-terminal domain.
22418839 His103 and Phe107 in hASB9-2 are essential for binding to CKB.
20878058 The results of the present study suggest that ASB9 is a useful prognostic marker for colorectal cancer
20302626 ASB9 interacts with the creatine kinase system and negatively regulates cell growth.
19275750 The purified ASB9-2 protein, the splice variant of ASB9 with only one ankyrin repeat domain, was crystallized and diffracted to 2.2A resolution.
18680464 The splice variant of hASB9, hASB9-2 protein, was cloned, overexpressed, and crystallized and the data showed that the cubic hASB9-2 crystal belongs to space group P4(3)32 with unit-cell parameters.

AA Sequence

MDGKQGGMDGSKPAGPRDFPGIRLLSNPLMGDAVSDWSPMHEAAIHGHQLSLRNLISQGWAVNIITADHV      1 - 70
SPLHEACLGGHLSCVKILLKHGAQVNGVTADWHTPLFNACVSGSWDCVNLLLQHGASVQPESDLASPIHE     71 - 140
AARRGHVECVNSLIAYGGNIDHKISHLGTPLYLACENQQRACVKKLLESGADVNQGKGQDSPLHAVARTA    141 - 210
SEELACLLMDFGADTQAKNAEGKRPVELVPPESPLAQLFLEREGPPSLMQLCRLRIRKCFGIQQHHKITK    211 - 280
LVLPEDLKQFLLHL                                                            281 - 294
//

Text Mined References (23)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25654263 2015 How the ankyrin and SOCS box protein, ASB9, binds to creatine kinase.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23837592 2013 Multimeric complexes among ankyrin-repeat and SOCS-box protein 9 (ASB9), ElonginBC, and Cullin 5: insights into the structure and assembly of ECS-type Cullin-RING E3 ubiquitin ligases.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22418839 2012 Crystal structure of Human ASB9-2 and substrate-recognition of CKB.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20878058 2010 Clinical significance of ASB9 in human colorectal cancer.
20302626 2010 ASB9 interacts with ubiquitous mitochondrial creatine kinase and inhibits mitochondrial function.
More...