Property Summary

NCBI Gene PubMed Count 21
PubMed Score 7.25
PubTator Score 11.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.5e-06
malignant mesothelioma 3232 1.5e-05
psoriasis 6694 6.8e-05
nasopharyngeal carcinoma 1058 2.2e-03

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.700 1.5e-05
nasopharyngeal carcinoma 1.400 2.2e-03
osteosarcoma -1.889 1.5e-06
psoriasis -1.900 6.8e-05

Protein-protein Interaction (9)

Gene RIF (8)

AA Sequence

MDGKQGGMDGSKPAGPRDFPGIRLLSNPLMGDAVSDWSPMHEAAIHGHQLSLRNLISQGWAVNIITADHV      1 - 70
SPLHEACLGGHLSCVKILLKHGAQVNGVTADWHTPLFNACVSGSWDCVNLLLQHGASVQPESDLASPIHE     71 - 140
AARRGHVECVNSLIAYGGNIDHKISHLGTPLYLACENQQRACVKKLLESGADVNQGKGQDSPLHAVARTA    141 - 210
SEELACLLMDFGADTQAKNAEGKRPVELVPPESPLAQLFLEREGPPSLMQLCRLRIRKCFGIQQHHKITK    211 - 280
LVLPEDLKQFLLHL                                                            281 - 294
//

Text Mined References (24)

PMID Year Title