Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma 1.075 2.4e-03
astrocytic glioma 1.200 1.0e-03
Astrocytoma, Pilocytic 1.100 6.1e-04
atypical teratoid / rhabdoid tumor 1.400 2.2e-04
glioblastoma 1.100 2.9e-04
group 4 medulloblastoma 1.400 1.2e-03
juvenile dermatomyositis 1.065 5.4e-12
oligodendroglioma 1.300 1.2e-03
ovarian cancer -1.100 1.3e-04
primitive neuroectodermal tumor 1.100 3.6e-04

 GO Function (1)

 GO Component (1)

Gene RIF (1)

AA Sequence

MIVFGWAVFLASRSLGQGLLLTLEEHIAHFLGTGGAATTMGNSCICRDDSGTDDSVDTQQQQAENSAVPT      1 - 70
ADTRSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQEPPYSMITLHEMAETDEGWLD     71 - 140
VVQSLIRVIPLEDPLGPAVITLLLDECPLPTKDALQKLTEILNLNGEVACQDSSHPAKHRNTSAVLGCLA    141 - 210
EKLAGPASIGLLSPGILEYLLQCLKLQSHPTVMLFALIALEKFAQTSENKLTISESSISDRLVTLESWAN    211 - 280
DPDYLKRQVGFCAQWSLDNLFLKEGRQLTYEKVNLSSIRAMLNSNDVSEYLKISPHGLEARCDASSFESV    281 - 350
RCTFCVDAGVWYYEVTVVTSGVMQIGWATRDSKFLNHEGYGIGDDEYSCAYDGCRQLIWYNARSKPHIHP    351 - 420
CWKEGDTVGFLLDLNEKQMIFFLNGNQLPPEKQVFSSTVSGFFAAASFMSYQQCEFNFGAKPFKYPPSMK    421 - 490
FSTFNDYAFLTAEEKIILPRHRRLALLKQVSIRENCCSLCCDEVADTQLKPCGHSDLCMDCALQLETCPL    491 - 560
CRKEIVSRIRQISHIS                                                          561 - 576
//

Text Mined References (8)

PMID Year Title