Property Summary

NCBI Gene PubMed Count 16
PubMed Score 12.18
PubTator Score 12.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.352 6.3e-06
ovarian cancer 1.200 1.1e-03

Gene RIF (10)

AA Sequence

MIQNSRPSLLQPQDVGDTVETLMLHPVIKAFLCGSISGTCSTLLFQPLDLLKTRLQTLQPSDHGSRRVGM      1 - 70
LAVLLKVVRTESLLGLWKGMSPSIVRCVPGVGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVC     71 - 140
MSPITVIKTRYESGKYGYESIYAALRSIYHSEGHRGLFSGLTATLLRDAPFSGIYLMFYNQTKNIVPHDQ    141 - 210
VDATLIPITNFSCGIFAGILASLVTQPADVIKTHMQLYPLKFQWIGQAVTLIFKDYGLRGFFQGGIPRAL    211 - 280
RRTLMAAMAWTVYEEMMAKMGLKS                                                  281 - 304
//

Text Mined References (18)

PMID Year Title