Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.44
PubTator Score 0.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Lymphoblastic lymphoma 1 3.311 1.7

Expression

AA Sequence

MAAPWWRAALCECRRWRGFSTSAVLGRRTPPLGPMPNSDIDLSNLERLEKYRSFDRYRRRAEQEAQAPHW      1 - 70
WRTYREYFGEKTDPKEKIDIGLPPPKVSRTQQLLERKQAIQELRANVEEERAARLRTASVPLDAVRAEWE     71 - 140
RTCGPYHKQRLAEYYGLYRDLFHGATFVPRVPLHVAYAVGEDDLMPVYCGNEVTPTEAAQAPEVTYEAEE    141 - 210
GSLWTLLLTSLDGHLLEPDAEYLHWLLTNIPGNRVAEGQVTCPYLPPFPARGSGIHRLAFLLFKQDQPID    211 - 280
FSEDARPSPCYQLAQRTFRTFDFYKKHQETMTPAGLSFFQCRWDDSVTYIFHQLLDMREPVFEFVRPPPY    281 - 350
HPKQKRFPHRQPLRYLDRYRDSHEPTYGIY                                            351 - 380
//

Text Mined References (14)

PMID Year Title