Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.56
PubTator Score 4.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
aldosterone-producing adenoma -1.126 6.9e-03
Astrocytoma, Pilocytic 2.400 8.2e-07
medulloblastoma 1.500 2.1e-02
non primary Sjogren syndrome sicca -1.100 2.6e-02
ovarian cancer -1.700 3.0e-15

Gene RIF (2)

AA Sequence

MGSGEPNPAGKKKKYLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGYGYVNFRFPA      1 - 70
DAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFIKNLDKSIDNRALFYLFSAFGNILSCKVVCD     71 - 140
DNGSKGYAYVHFDSLAAANRAIWHMNGVRLNNRQVYVGRFKFPEERAAEVRTRDRATFTNVFVKNIGDDI    141 - 210
DDEKLKELFCEYGPTESVKVIRDASGKSKGFGFVRYETHEAAQKAVLDLHGKSIDGKVLYVGRAQKKIER    211 - 280
LAELRRRFERLRLKEKSRPPGVPIYIKNLDETINDEKLKEEFSSFGSISRAKVMMEVGQGKGFGVVCFSS    281 - 350
FEEATKAVDEMNGRIVGSKPLHVTLGQARRRC                                          351 - 382
//

Text Mined References (10)

PMID Year Title