Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.56
PubTator Score 4.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Gene RIF (2)

PMID Text
23300856 although function of PABPN1 may be compensated by nuclear translocation of PABP4 and perhaps by increase the cytoplasmic abundance of PABP5, these were not sufficient to prevent apoptosis of cells. PABPN1 may have an anti apoptotic role in mammalian cells
19956697 HIV-1 PR-induced PABP cleavage is involved in the inhibition of poly(A)-dependent translation. However, PABP cleavage has little impact on the translation of polyadenylated encephalomyocarditis virus internal ribosome entry site-containing mRNAs

AA Sequence

MGSGEPNPAGKKKKYLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGYGYVNFRFPA      1 - 70
DAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFIKNLDKSIDNRALFYLFSAFGNILSCKVVCD     71 - 140
DNGSKGYAYVHFDSLAAANRAIWHMNGVRLNNRQVYVGRFKFPEERAAEVRTRDRATFTNVFVKNIGDDI    141 - 210
DDEKLKELFCEYGPTESVKVIRDASGKSKGFGFVRYETHEAAQKAVLDLHGKSIDGKVLYVGRAQKKIER    211 - 280
LAELRRRFERLRLKEKSRPPGVPIYIKNLDETINDEKLKEEFSSFGSISRAKVMMEVGQGKGFGVVCFSS    281 - 350
FEEATKAVDEMNGRIVGSKPLHVTLGQARRRC                                          351 - 382
//

Text Mined References (10)

PMID Year Title
23300856 2012 Depletion of nuclear poly(A) binding protein PABPN1 produces a compensatory response by cytoplasmic PABP4 and PABP5 in cultured human cells.
23275553 2013 Alternative translation initiation augments the human mitochondrial proteome.
22808956 2012 Genetically distinct subsets within ANCA-associated vasculitis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11374897 2001 A novel poly(A)-binding protein gene (PABPC5) maps to an X-specific subinterval in the Xq21.3/Yp11.2 homology block of the human sex chromosomes.