Property Summary

NCBI Gene PubMed Count 25
PubMed Score 23.40
PubTator Score 32.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Coronary aneurysm 4 0.0 0.0
Mucocutaneous Lymph Node Syndrome 4 0.0 0.0
Disease Target Count
Infantile polyarteritis 1
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Kawasaki disease 28 6.156 3.1
Disease Target Count Z-score Confidence
Vasculitis 80 4.524 2.3

Expression

  Differential Expression (9)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 1.5e-05
atypical teratoid / rhabdoid tumor 1.500 1.3e-05
glioblastoma 1.100 4.2e-04
lung cancer -1.100 4.2e-03
lung carcinoma -1.500 2.7e-07
ovarian cancer 1.100 3.5e-08
primary Sjogren syndrome -1.100 1.6e-02
psoriasis 1.600 3.6e-04
spina bifida -1.894 4.0e-02

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (21)

AA Sequence

MRRCPCRGSLNEAEAGALPAAARMGLEAPRGGRRRQPGQQRPGPGAGAPAGRPEGGGPWARTEGSSLHSE      1 - 70
PERAGLGPAPGTESPQAEFWTDGQTEPAAAGLGVETERPKQKTEPDRSSLRTHLEWSWSELETTCLWTET     71 - 140
GTDGLWTDPHRSDLQFQPEEASPWTQPGVHGPWTELETHGSQTQPERVKSWADNLWTHQNSSSLQTHPEG    141 - 210
ACPSKEPSADGSWKELYTDGSRTQQDIEGPWTEPYTDGSQKKQDTEAARKQPGTGGFQIQQDTDGSWTQP    211 - 280
STDGSQTAPGTDCLLGEPEDGPLEEPEPGELLTHLYSHLKCSPLCPVPRLIITPETPEPEAQPVGPPSRV    281 - 350
EGGSGGFSSASSFDESEDDVVAGGGGASDPEDRSGSKPWKKLKTVLKYSPFVVSFRKHYPWVQLSGHAGN    351 - 420
FQAGEDGRILKRFCQCEQRSLEQLMKDPLRPFVPAYYGMVLQDGQTFNQMEDLLADFEGPSIMDCKMGSR    421 - 490
TYLEEELVKARERPRPRKDMYEKMVAVDPGAPTPEEHAQGAVTKPRYMQWRETMSSTSTLGFRIEGIKKA    491 - 560
DGTCNTNFKKTQALEQVTKVLEDFVDGDHVILQKYVACLEELREALEISPFFKTHEVVGSSLLFVHDHTG    561 - 630
LAKVWMIDFGKTVALPDHQTLSHRLPWAEGNREDGYLWGLDNMICLLQGLAQS                     631 - 683
//

Text Mined References (28)

PMID Year Title