Property Summary

NCBI Gene PubMed Count 13
PubMed Score 9.57
PubTator Score 8.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
astrocytoma 1493 3.69655223047423E-14
psoriasis 6685 6.34638058783404E-14
oligodendroglioma 2849 6.57605536824129E-12
malignant mesothelioma 3163 1.17085903694225E-8
acute quadriplegic myopathy 1157 3.30576768088931E-8
ependymoma 2514 7.19751780344464E-8
medulloblastoma 1524 7.96233416349216E-8
primitive neuroectodermal tumor 3031 3.15485909959577E-6
atypical teratoid / rhabdoid tumor 4369 8.39798753843979E-6
hepatocellular carcinoma 550 9.12709369094413E-6
pediatric high grade glioma 2712 7.24515234227154E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.08352805330155E-4
medulloblastoma, large-cell 6234 2.537516808556E-4
interstitial cystitis 2299 5.25517255394108E-4
glioblastoma 5572 5.39743912809182E-4
tuberculosis and treatment for 6 months 686 7.82094832898732E-4
osteosarcoma 7933 7.86237291133506E-4
gastric cancer 436 0.0010407888452318
pancreatic carcinoma 567 0.00514943280496017
pancreatic cancer 2300 0.00514943280496045
colon cancer 1475 0.00653370161579235
sarcoidosis 368 0.00763452734969868
chronic rhinosinusitis 512 0.00800706504388131
acute myeloid leukemia 785 0.00923439365460412
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00980979664279736
ulcerative colitis 2087 0.0165147239224935
Rheumatoid Arthritis 1171 0.0182743233838532
ovarian cancer 8492 0.024316863011445
aldosterone-producing adenoma 664 0.028589675641706
Breast cancer 3099 0.0301770928976917
intraductal papillary-mucinous adenoma (IPMA) 2956 0.036390556506081
Disease Target Count Z-score Confidence
Hypothyroidism 89 0.0 1.0

Expression

Synonym

Accession Q96DT7 A4FVD0 Q86W96 Q8IXI9 Q96MH9
Symbols RINZF

Gene

  Ortholog (9)

 GWAS Trait (1)

Pathway (1)

Gene RIF (3)

PMID Text
23471840 Sp1, Sp3, and Sp4 and Sp-regulated genes were downregulated by curcuminoids in SW-480 and this was accompanied by suppression of microRNA-27a (miR-27a) and induction of ZBTB10, an mRNA target of miR-27a and a transcriptional repressor of Sp expression.
23254909 Collectively, these results indicated that stimulation of ovarian cancer cell VEGF, Cox2 and survivin expression by FSH involves the microRNA27a: ZBTB10-specificity protein pathway.
20382698 Study show that miR-27a indirectly regulates E2-responsiveness in MCF-7 cells through suppression of ZBTB10, thereby enhancing expression of ERalpha.

AA Sequence

MSFSEMNRRTLAFRGGGLVTASGGGSTNNNAGGEASAWPPQPQPRQPPPPAPPALQPPNGRGADEEVELE      1 - 70
GLEPQDLEASAGPAAGAAEEAKELLLPQDAGGPTSLGGGAGGPLLAERNRRTLAFRGGGGGGLGNNGSSR     71 - 140
GRPETSVWPLRHFNGRGPATVDLELDALEGKELMQDGASLSDSTEDEEEGASLGDGSGAEGGSCSSSRRS    141 - 210
GGDGGDEVEGSGVGAGEGETVQHFPLARPKSLMQKLQCSFQTSWLKDFPWLRYSKDTGLMSCGWCQKTPA    211 - 280
DGGSVDLPPVGHDELSRGTRNYKKTLLLRHHVSTEHKLHEANAQESEIPSEEGYCDFNSRPNENSYCYQL    281 - 350
LRQLNEQRKKGILCDVSIVVSGKIFKAHKNILVAGSRFFKTLYCFSNKESPNQNNTTHLDIAAVQGFSVI    351 - 420
LDFLYSGNLVLTSQNAIEVMTVASYLQMSEVVQTCRNFIKDALNISIKSEAPESVVVDYNNRKPVNRDGL    421 - 490
SSSRDQKIASFWATRNLTNLASNVKIENDGCNVDEGQIENYQMNDSSWVQDGSPEMAENESEGQTKVFIW    491 - 560
NNMGSQGIQETGKTRRKNQTTKRFIYNIPPNNETNLEDCSVMQPPVAYPEENTLLIKEEPDLDGALLSGP    561 - 630
DGDRNVNANLLAEAGTSQDGGDAGTSHDFKYGLMPGPSNDFKYGLIPGTSNDFKYGLIPGASNDFKYGLL    631 - 700
PESWPKQETWENGESSLIMNKLKCPHCSYVAKYRRTLKRHLLIHTGVRSFSCDICGKLFTRREHVKRHSL    701 - 770
VHKKDKKYKCMVCKKIFMLAASVGIRHGSRRYGVCVDCADKSQPGGQEGVDQGQDTEFPRDEEYEENEVG    771 - 840
EADEELVDDGEDQNDPSRWDESGEVCMSLDD                                           841 - 871
//

Text Mined References (22)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24388013 2014 Genome-wide association analysis identifies 11 risk variants associated with the asthma with hay fever phenotype.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23471840 2013 The drug resistance suppression induced by curcuminoids in colon cancer SW-480 cells is mediated by reactive oxygen species-induced disruption of the microRNA-27a-ZBTB10-Sp axis.
23254909 2013 The microRNA-27a: ZBTB10-specificity protein pathway is involved in follicle stimulating hormone-induced VEGF, Cox2 and survivin expression in ovarian epithelial cancer cells.
22829776 2012 A genome-wide association meta-analysis of circulating sex hormone-binding globulin reveals multiple Loci implicated in sex steroid hormone regulation.
More...