Property Summary

NCBI Gene PubMed Count 13
PubMed Score 9.65
PubTator Score 8.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
acute myeloid leukemia 1.400 9.2e-03
acute quadriplegic myopathy 1.443 3.3e-08
aldosterone-producing adenoma -1.268 2.9e-02
astrocytoma 1.100 3.7e-14
atypical teratoid / rhabdoid tumor 1.800 4.2e-04
Breast cancer 3.200 3.0e-02
chronic rhinosinusitis -1.021 8.0e-03
colon cancer -2.000 6.5e-03
ependymoma 1.600 5.7e-07
gastric cancer -1.200 3.8e-03
glioblastoma 1.400 1.9e-06
group 3 medulloblastoma 1.700 1.1e-02
hepatocellular carcinoma -1.700 9.1e-06
interstitial cystitis -1.500 5.3e-04
intraductal papillary-mucinous adenoma (... -1.200 3.6e-02
intraductal papillary-mucinous carcinoma... -1.900 6.7e-04
intraductal papillary-mucinous neoplasm ... -1.800 2.1e-02
malignant mesothelioma 3.100 1.2e-08
medulloblastoma, large-cell 2.200 1.9e-03
oligodendroglioma 1.200 6.6e-12
osteosarcoma 1.411 7.9e-04
ovarian cancer 1.100 2.4e-02
pancreatic cancer -1.200 1.7e-02
pancreatic carcinoma -1.200 1.7e-02
pediatric high grade glioma 1.500 7.2e-05
primitive neuroectodermal tumor 1.800 1.2e-05
psoriasis -1.200 8.9e-11
Rheumatoid arthritis 1.200 1.8e-02
sarcoidosis 1.300 7.6e-03
tuberculosis and treatment for 6 months 1.400 7.8e-04
ulcerative colitis -1.400 1.7e-03

Gene RIF (3)

AA Sequence

MSFSEMNRRTLAFRGGGLVTASGGGSTNNNAGGEASAWPPQPQPRQPPPPAPPALQPPNGRGADEEVELE      1 - 70
GLEPQDLEASAGPAAGAAEEAKELLLPQDAGGPTSLGGGAGGPLLAERNRRTLAFRGGGGGGLGNNGSSR     71 - 140
GRPETSVWPLRHFNGRGPATVDLELDALEGKELMQDGASLSDSTEDEEEGASLGDGSGAEGGSCSSSRRS    141 - 210
GGDGGDEVEGSGVGAGEGETVQHFPLARPKSLMQKLQCSFQTSWLKDFPWLRYSKDTGLMSCGWCQKTPA    211 - 280
DGGSVDLPPVGHDELSRGTRNYKKTLLLRHHVSTEHKLHEANAQESEIPSEEGYCDFNSRPNENSYCYQL    281 - 350
LRQLNEQRKKGILCDVSIVVSGKIFKAHKNILVAGSRFFKTLYCFSNKESPNQNNTTHLDIAAVQGFSVI    351 - 420
LDFLYSGNLVLTSQNAIEVMTVASYLQMSEVVQTCRNFIKDALNISIKSEAPESVVVDYNNRKPVNRDGL    421 - 490
SSSRDQKIASFWATRNLTNLASNVKIENDGCNVDEGQIENYQMNDSSWVQDGSPEMAENESEGQTKVFIW    491 - 560
NNMGSQGIQETGKTRRKNQTTKRFIYNIPPNNETNLEDCSVMQPPVAYPEENTLLIKEEPDLDGALLSGP    561 - 630
DGDRNVNANLLAEAGTSQDGGDAGTSHDFKYGLMPGPSNDFKYGLIPGTSNDFKYGLIPGASNDFKYGLL    631 - 700
PESWPKQETWENGESSLIMNKLKCPHCSYVAKYRRTLKRHLLIHTGVRSFSCDICGKLFTRREHVKRHSL    701 - 770
VHKKDKKYKCMVCKKIFMLAASVGIRHGSRRYGVCVDCADKSQPGGQEGVDQGQDTEFPRDEEYEENEVG    771 - 840
EADEELVDDGEDQNDPSRWDESGEVCMSLDD                                           841 - 871
//

Text Mined References (23)

PMID Year Title