Property Summary

NCBI Gene PubMed Count 12
Grant Count 22
R01 Count 11
Funding $4,976,290.33
PubMed Score 128.68
PubTator Score 3.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer 1.100 0.044
hepatocellular carcinoma 1.500 0.000
pancreatic cancer 1.700 0.013
medulloblastoma, large-cell -1.200 0.000
pancreatic carcinoma 1.700 0.013
progressive supranuclear palsy -1.200 0.012
ovarian cancer -1.100 0.000

Gene RIF (2)

PMID Text
25490467 HIV-1 Vif binds more strongly to autophagy-related protein 4 (ATG4)-cleaved form I (LC3-I) than to ATG4-cleaved form II (LC3-II) in an A3G-independent manner
22248718 miR-376b controls autophagy by directly regulating intracellular levels of two key autophagy proteins, ATG4C and BECN1.

AA Sequence

MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDH      1 - 70
VIAGNVEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALN     71 - 140
IENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLA    141 - 210
LFGLHQLIEYGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMT    211 - 280
SDNADDKAVIILVPVRLGGERTNTDYLEFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQ    281 - 350
SFVDVSIKDFPLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFKRASEEITKMLKFSSKEKYPLFTFVN    351 - 420
GHSRDYDFTSTTTNEEDLFSEDEKKQLKRFSTEEFVLL                                    421 - 458
//

Text Mined References (16)

PMID Year Title
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22248718 2012 miR-376b controls starvation and mTOR inhibition-related autophagy by targeting ATG4C and BECN1.
21177865 2011 Kinetics comparisons of mammalian Atg4 homologues indicate selective preferences toward diverse Atg8 substrates.
20966902 2011 Genome-wide association study of anthropometric traits and evidence of interactions with age and study year in Filipino women.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18193044 2008 Six new loci associated with blood low-density lipoprotein cholesterol, high-density lipoprotein cholesterol or triglycerides in humans.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17442669 2007 Tissue-specific autophagy alterations and increased tumorigenesis in mice deficient in Atg4C/autophagin-3.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...