Property Summary

NCBI Gene PubMed Count 13
PubMed Score 146.49
PubTator Score 3.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer 1.100 4.4e-02
hepatocellular carcinoma 1.500 3.2e-04
medulloblastoma, large-cell -1.200 3.4e-04
ovarian cancer -1.100 1.6e-05
pancreatic cancer 1.700 1.3e-02
pancreatic carcinoma 1.700 1.3e-02
progressive supranuclear palsy -1.200 1.2e-02

Gene RIF (3)

AA Sequence

MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDH      1 - 70
VIAGNVEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALN     71 - 140
IENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLA    141 - 210
LFGLHQLIEYGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMT    211 - 280
SDNADDKAVIILVPVRLGGERTNTDYLEFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQ    281 - 350
SFVDVSIKDFPLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFKRASEEITKMLKFSSKEKYPLFTFVN    351 - 420
GHSRDYDFTSTTTNEEDLFSEDEKKQLKRFSTEEFVLL                                    421 - 458
//

Text Mined References (17)

PMID Year Title