Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.92
PubTator Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Alzheimer's disease 658 3.365 1.7

Expression

Gene RIF (2)

AA Sequence

MTSQPISNETIIMLPSNVINFSQAEKPEPTNQGQDSLKKRLQAKVKVIGVHSSLAGSILSALSALVGFIL      1 - 70
LSVNPAALNPASLQCKLDEKDIPTRLLLSYDYHSPYTMDCHRAKASLAGTLSLMLVSTVLEFCLAVLTAV     71 - 140
LQWKQTV                                                                   141 - 147
//

Text Mined References (5)

PMID Year Title