Property Summary

NCBI Gene PubMed Count 14
Grant Count 6
Funding $2,102,607.08
PubMed Score 40.18
PubTator Score 10.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
invasive ductal carcinoma -2.636 0.006
inflammatory breast cancer -4.700 0.037
breast carcinoma -1.800 0.000
psoriasis -1.400 0.000

Gene RIF (6)

PMID Text
20364301 SBEM has the potential to be a specific marker for predicting hematogenous micrometastasis and response to neoadjuvant chemotherapy in breast cancer.
19221791 The SBEM might a suitable marker for molecular detection of ITCs in BM in breast cancer patients. Analysis of prognostic value for SBEM mRNA-based assay should take into account the heterogeneity and different molecular subtypes of breast cancer.
18497056 results demonstrate that SBEM mRNA may be an important marker for targeting breast cancer micrometastasis
18269587 SBEM may identify a unique subset of breast cancers with poor prognosis and have implications for therapeutic management.
16720387 octamer-binding transcription factors participate in the strong expression of SBEM gene in breast tissues
15684711 identification as possible new breast tumor biomarker

AA Sequence

MKFLAVLVLLGVSIFLVSAQNPTTAAPADTYPATGPADDEAPDAETTAAATTATTAAPTTATTAASTTAR      1 - 70
KDIPVLPKWVGDLPNGRVCP                                                       71 - 90
//

Text Mined References (15)

PMID Year Title
20364301 2010 Small breast epithelial mucin (SBEM) has the potential to be a marker for predicting hematogenous micrometastasis and response to neoadjuvant chemotherapy in breast cancer.
19221791 2009 Diagnostic accuracy of small breast epithelial mucin mRNA as a marker for bone marrow micrometastasis in breast cancer: a pilot study.
18497056 2008 In silico and in vitro analysis of small breast epithelial mucin as a marker for bone marrow micrometastasis in breast cancer.
18269587 2008 Expression of small breast epithelial mucin (SBEM) protein in tissue microarrays (TMAs) of primary invasive breast cancers.
16720387 2006 Identification of an octamer-binding site controlling the activity of the small breast epithelial mucin gene promoter.
15880534 2005 Serological identification of breast cancer-related antigens from a Saccharomyces cerevisiae surface display library.
15684711 2004 Human small breast epithelial mucin: the promise of a new breast tumor biomarker.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15096563 2004 Identification of MGB1 as a marker in the differential diagnosis of lung tumors in patients with a history of breast cancer by analysis of publicly available SAGE data.
More...