Property Summary

NCBI Gene PubMed Count 15
PubMed Score 45.66
PubTator Score 10.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 9.4e-21
breast carcinoma 1638 4.0e-07
Breast cancer 3578 6.1e-04
invasive ductal carcinoma 2951 6.0e-03
Disease Target Count Z-score Confidence
Pleural empyema 12 3.468 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer -2.700 6.1e-04
breast carcinoma -1.800 4.0e-07
invasive ductal carcinoma -2.636 6.0e-03
psoriasis -1.400 9.4e-21

Gene RIF (7)

AA Sequence

MKFLAVLVLLGVSIFLVSAQNPTTAAPADTYPATGPADDEAPDAETTAAATTATTAAPTTATTAASTTAR      1 - 70
KDIPVLPKWVGDLPNGRVCP                                                       71 - 90
//

Text Mined References (16)

PMID Year Title