Property Summary

NCBI Gene PubMed Count 17
PubMed Score 50.48
PubTator Score 66.95

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MLQLWKLVLLCGVLTGTSESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSA      1 - 70
WQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPII     71 - 140
GQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSS    141 - 210
LLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI                                   211 - 249
//

Text Mined References (17)

PMID Year Title