Property Summary

NCBI Gene PubMed Count 17
PubMed Score 47.82
PubTator Score 66.95

Knowledge Summary


No data available

Gene RIF (2)

21833535 PSP is a lipopolysaccharide-binding protein that is functionally related to lipopolysaccharide-binding protein, as suggested by their predicted structural similarities
19499239 multiple SPLUNC2 isoforms are found in the oral cavity and suggest that these proteins may be differentially regulated in distinct tissues where they may function in the innate immune response.

AA Sequence

LLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI                                   211 - 249

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24581853 2014 Isolation, biochemical characterization and anti-bacterial activity of BPIFA2 protein.
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
21833535 2012 Human parotid secretory protein is a lipopolysaccharide-binding protein: identification of an anti-inflammatory peptide domain.
21787342 2011 Dual host-defence functions of SPLUNC2/PSP and synthetic peptides derived from the protein.
21787333 2011 Systematic nomenclature for the PLUNC/PSP/BSP30/SMGB proteins as a subfamily of the BPI fold-containing superfamily.
19499239 2009 Characterisation and expression of SPLUNC2, the human orthologue of rodent parotid secretory protein.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18221458 2008 Expression of PLUNC family members in benign and malignant salivary gland tumours.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.