Property Summary

NCBI Gene PubMed Count 15
Grant Count 6
R01 Count 4
Funding $499,860.27
PubMed Score 14.56
PubTator Score 13.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
ependymoma -1.200 0.011
group 4 medulloblastoma -1.800 0.000
adrenocortical carcinoma 1.148 0.043
pancreatic ductal adenocarcinoma liver m... -1.378 0.006
active Crohn's disease 1.444 0.005
ulcerative colitis 1.100 0.000
interstitial cystitis 1.100 0.003
lung carcinoma -1.800 0.000
Pick disease -1.500 0.000
progressive supranuclear palsy -1.400 0.016
pituitary cancer 1.500 0.000
psoriasis 1.200 0.000

Gene RIF (11)

PMID Text
24440759 Studies show the 3 steroidogenic acute regulatory-related lipid transfer (START) domain proteins StarD4, StarD5 and StarD6 have a similar lipid binding pocket specific for sterols (cholesterol in particular), but differing regulation and localization.
23033213 The data indicate a role for STARD4 in nonvesicular transport of cholesterol from the plasma membrane and the endocytic recycling compartment to the endoplasmic reticulum and perhaps other intracellular compartments as well.
21900492 cholesterol transport mediated by STARD4 is an important component of the cholesterol homeostasis regulatory machinery
21767660 Study provide strong evidence for StarD4 as a highly regulated, non-vesicular, directional, intracellular transporter of cholesterol which plays a key role in the maintenance of intracellular cholesterol homeostasis.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20059974 StarD4-accelerated 7 alpha-OOH transfer to mitochondria resulted in greater susceptibility to free radical lipid peroxidation and loss of membrane potential than in a non-StarD4 control.
19913121 Observational study of gene-disease association. (HuGE Navigator)
18403318 StarD4 plays an important role as a directional cholesterol transporter in the maintenance of cellular cholesterol homeostasis
16579971 Induction of STARD4 depended on both transcription factor ATF6 and an ERSE-like element in its promoter.
More...

AA Sequence

MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHI      1 - 70
RPGPCRLDWDSLMTSLDILENFEENCCVMRYTTAGQLWNIISPREFVDFSYTVGYKEGLLSCGISLDWDE     71 - 140
KRPEFVRGYNHPCGWFCVPLKDNPNQSLLTGYIQTDLRGMIPQSAVDTAMASTLTNFYGDLRKAL         141 - 205
//

Text Mined References (17)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24440759 2014 The StarD4 subfamily of steroidogenic acute regulatory-related lipid transfer (START) domain proteins: new players in cholesterol metabolism.
23033213 2012 STARD4 knockdown in HepG2 cells disrupts cholesterol trafficking associated with the plasma membrane, ER, and ERC.
21900492 2011 STARD4 abundance regulates sterol transport and sensing.
21767660 2011 Subcellular localization and regulation of StarD4 protein in macrophages and fibroblasts.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20059974 2010 StarD4-mediated translocation of 7-hydroperoxycholesterol to isolated mitochondria: deleterious effects and implications for steroidogenesis under oxidative stress conditions.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18403318 2008 Intracellular cholesterol transporter StarD4 binds free cholesterol and increases cholesteryl ester formation.
More...