Property Summary

NCBI Gene PubMed Count 9
PubMed Score 226.47
PubTator Score 11.31

Knowledge Summary


No data available


  Differential Expression (1)

Disease log2 FC p
astrocytic glioma -1.400 0.025


Accession Q96DP5 B7Z734 MtFMT
Symbols FMT1


PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Fruitfly EggNOG Inparanoid

 MGI Term (1)

Gene RIF (5)

25288793 Data indicate that methionyl-tRNA formyltransferase (MTF) mutation initiated poor formylation of mitochondrial methionyl-tRNA and thereby reduced mitochondrial translation efficiency, causing Leigh syndrome.
25288793 Recessive mutations in MTFMT underlie defects of the mitochondrial respiratory chain, leading to multi-system disease that includes Leigh syndrome. This paper reports on the biochemical activity of such mutant alleles.
24461907 We provide detailed clinical descriptions on eleven MTFMT patients and review five previously reported cases
21907147 Mutations in MTFMT underlie a human disorder of formylation causing impaired mitochondrial translation.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

HPWYQKNSQAQPSQCRFQTLRLPTKKKQKKTVAMQQCIE                                   351 - 389

Text Mined References (10)

PMID Year Title
25288793 2014 Biochemical characterization of pathogenic mutations in human mitochondrial methionyl-tRNA formyltransferase.
24461907 2014 Phenotypic spectrum of eleven patients and five novel MTFMT mutations identified by exome sequencing and candidate gene screening.
22499348 2012 Molecular diagnosis in mitochondrial complex I deficiency using exome sequencing.
21907147 2011 Mutations in MTFMT underlie a human disorder of formylation causing impaired mitochondrial translation.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9614118 1998 Mammalian mitochondrial methionyl-tRNA transformylase from bovine liver. Purification, characterization, and gene structure.