Property Summary

NCBI Gene PubMed Count 9
PubMed Score 264.82
PubTator Score 11.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
astrocytic glioma -1.400 2.5e-02

 MGI Phenotype (1)

Gene RIF (5)

AA Sequence

MRVLVRRCWGPPLAHGARRGRPSPQWRALARLGWEDCRDSRVREKPPWRVLFFGTDQFAREALRALHAAR      1 - 70
ENKEEELIDKLEVVTMPSPSPKGLPVKQYAVQSQLPVYEWPDVGSGEYDVGVVASFGRLLNEALILKFPY     71 - 140
GILNVHPSCLPRWRGPAPVIHTVLHGDTVTGVTIMQIRPKRFDVGPILKQETVPVPPKSTAKELEAVLSR    141 - 210
LGANMLISVLKNLPESLSNGRQQPMEGATYAPKISAGTSCIKWEEQTSEQIFRLYRAIGNIIPLQTLWMA    211 - 280
NTIKLLDLVEVNSSVLADPKLTGQALIPGSVIYHKQSQILLVYCKDGWIGVRSVMLKKSLTATDFYNGYL    281 - 350
HPWYQKNSQAQPSQCRFQTLRLPTKKKQKKTVAMQQCIE                                   351 - 389
//

Text Mined References (10)

PMID Year Title