Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.57
PubTator Score 3.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 1.800 8.1e-04
astrocytic glioma 1.500 9.6e-03
atypical teratoid / rhabdoid tumor 1.200 3.1e-05
ependymoma 1.700 1.6e-02
glioblastoma 1.200 1.4e-03
group 3 medulloblastoma 1.700 3.3e-04
intraductal papillary-mucinous adenoma (... 1.100 3.7e-02
intraductal papillary-mucinous neoplasm ... 1.200 3.7e-02
medulloblastoma, large-cell 1.200 4.1e-04
oligodendroglioma 1.800 4.6e-03
osteosarcoma -3.489 8.0e-07
ovarian cancer 2.500 2.1e-09
primitive neuroectodermal tumor 1.200 2.7e-03

Synonym

Accession Q96DN6 Q8N3M0 Q8NA81 Q96Q00
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

Gene RIF (6)

AA Sequence

MNGGNESSGADRAGGPVATSVPIGWQRCVREGAVLYISPSGTELSSLEQTRSYLLSDGTCKCGLECPLNV      1 - 70
PKVFNFDPLAPVTPGGAGVGPASEEDMTKLCNHRRKAVAMATLYRSMETTCSHSSPGEGASPQMFHTVSP     71 - 140
GPPSARPPCRVPPTTPLNGGPGSLPPEPPSVSQAFPTLAGPGGLFPPRLADPVPSGGSSSPRFLPRGNAP    141 - 210
SPAPPPPPAISLNAPSYNWGAALRSSLVPSDLGSPPAPHASSSPPSDPPLFHCSDALTPPPLPPSNNLPA    211 - 280
HPGPASQPPVSSATMHLPLVLGPLGGAPTVEGPGAPPFLASSLLSAAAKAQHPPLPPPSTLQGRRPRAQA    281 - 350
PSASHSSSLRPSQRRPRRPPTVFRLLEGRGPQTPRRSRPRAPAPVPQPFSLPEPSQPILPSVLSLLGLPT    351 - 420
PGPSHSDGSFNLLGSDAHLPPPPTLSSGSPPQPRHPIQPSLPGTTSGSLSSVPGAPAPPAASKAPVVPSP    421 - 490
VLQSPSEGLGMGAGPACPLPPLAGGEAFPFPSPEQGLALSGAGFPGMLGALPLPLSLGQPPPSPLLNHSL    491 - 560
FGVLTGGGGQPPPEPLLPPPGGPGPPLAPGEPEGPSLLVASLLPPPPSDLLPPPSAPPSNLLASFLPLLA    561 - 630
LGPTAGDGEGSAEGAGGPSGEPFSGLGDLSPLLFPPLSAPPTLIALNSALLAATLDPPSGTPPQPCVLSA    631 - 700
PQPGPPTSSVTTATTDPGASSLGKAPSNSGRPPQLLSPLLGASLLGDLSSLTSSPGALPSLLQPPGPLLS    701 - 770
GQLGLQLLPGGGAPPPLSEASSPLACLLQSLQIPPEQPEAPCLPPESPASALEPEPARPPLSALAPPHGS    771 - 840
PDPPVPELLTGRGSGKRGRRGGGGLRGINGEARPARGRKPGSRREPGRLALKWGTRGGFNGQMERSPRRT    841 - 910
HHWQHNGELAEGGAEPKDPPPPGPHSEDLKVPPGVVRKSRRGRRRKYNPTRNSNSSRQDITLEPSPTARA    911 - 980
AVPLPPRARPGRPAKNKRRKLAP                                                   981 - 1003
//

Text Mined References (14)

PMID Year Title