Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.57
PubTator Score 3.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Peripheral Neuropathy 303
Disease Target Count P-value
glioblastoma multiforme 347 6.56448259726029E-14
ovarian cancer 8492 2.05313863750814E-9
osteosarcoma 7933 8.00844087536653E-7
atypical teratoid / rhabdoid tumor 4369 3.05273246561131E-5
group 3 medulloblastoma 2254 3.34925029781787E-4
medulloblastoma, large-cell 6234 4.08150079149273E-4
adult high grade glioma 2148 8.12511242028406E-4
oligodendroglioma 2849 0.002502220855185
primitive neuroectodermal tumor 3031 0.00265700084670605
astrocytic glioma 2241 0.0096159076051106
ependymoma 2514 0.0144241321716555
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0371748614333724
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0374597305429895
Disease Target Count Z-score Confidence
Rett syndrome 18 3.588 1.8

Expression

Synonym

Accession Q96DN6 Q8N3M0 Q8NA81 Q96Q00
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Anole lizard OMA Inparanoid

 MGI Term (1)

Gene RIF (5)

PMID Text
25638327 Frameshift mutations of MBD6 gene is associated with stomach and colorectal cancers.
24634419 We studied and showed that both MBD5 and MBD6 interact with the mammalian PR-DUB Polycomb protein complex in a mutually exclusive manner, and that the MBD of MBD5 and MBD6 is both necessary and sufficient to mediate this interaction.
23055267 This study demonstrates examples of autistic patients carrying alterations in MBD6.
23052207 MBD6 is regulated by Ago2 via an interaction with Oct4, which alters self-renewal and gene expression in human adipose tissue-derived stem cells.
20700456 MBD5 and MBD6 are unlikely to be methyl-binding proteins, yet they may contribute to the formation or function of heterochromatin.

AA Sequence

MNGGNESSGADRAGGPVATSVPIGWQRCVREGAVLYISPSGTELSSLEQTRSYLLSDGTCKCGLECPLNV      1 - 70
PKVFNFDPLAPVTPGGAGVGPASEEDMTKLCNHRRKAVAMATLYRSMETTCSHSSPGEGASPQMFHTVSP     71 - 140
GPPSARPPCRVPPTTPLNGGPGSLPPEPPSVSQAFPTLAGPGGLFPPRLADPVPSGGSSSPRFLPRGNAP    141 - 210
SPAPPPPPAISLNAPSYNWGAALRSSLVPSDLGSPPAPHASSSPPSDPPLFHCSDALTPPPLPPSNNLPA    211 - 280
HPGPASQPPVSSATMHLPLVLGPLGGAPTVEGPGAPPFLASSLLSAAAKAQHPPLPPPSTLQGRRPRAQA    281 - 350
PSASHSSSLRPSQRRPRRPPTVFRLLEGRGPQTPRRSRPRAPAPVPQPFSLPEPSQPILPSVLSLLGLPT    351 - 420
PGPSHSDGSFNLLGSDAHLPPPPTLSSGSPPQPRHPIQPSLPGTTSGSLSSVPGAPAPPAASKAPVVPSP    421 - 490
VLQSPSEGLGMGAGPACPLPPLAGGEAFPFPSPEQGLALSGAGFPGMLGALPLPLSLGQPPPSPLLNHSL    491 - 560
FGVLTGGGGQPPPEPLLPPPGGPGPPLAPGEPEGPSLLVASLLPPPPSDLLPPPSAPPSNLLASFLPLLA    561 - 630
LGPTAGDGEGSAEGAGGPSGEPFSGLGDLSPLLFPPLSAPPTLIALNSALLAATLDPPSGTPPQPCVLSA    631 - 700
PQPGPPTSSVTTATTDPGASSLGKAPSNSGRPPQLLSPLLGASLLGDLSSLTSSPGALPSLLQPPGPLLS    701 - 770
GQLGLQLLPGGGAPPPLSEASSPLACLLQSLQIPPEQPEAPCLPPESPASALEPEPARPPLSALAPPHGS    771 - 840
PDPPVPELLTGRGSGKRGRRGGGGLRGINGEARPARGRKPGSRREPGRLALKWGTRGGFNGQMERSPRRT    841 - 910
HHWQHNGELAEGGAEPKDPPPPGPHSEDLKVPPGVVRKSRRGRRRKYNPTRNSNSSRQDITLEPSPTARA    911 - 980
AVPLPPRARPGRPAKNKRRKLAP                                                   981 - 1003
//

Text Mined References (13)

PMID Year Title
25638327 2015 Mutation and expression of a methyl-binding protein 6 (MBD6) in gastric and colorectal cancers.
24634419 2014 MBD5 and MBD6 interact with the human PR-DUB complex through their methyl-CpG-binding domain.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23055267 2012 The expanding role of MBD genes in autism: identification of a MECP2 duplication and novel alterations in MBD5, MBD6, and SETDB1.
23052207 2013 MBD6 is a direct target of Oct4 and controls the stemness and differentiation of adipose tissue-derived stem cells.
20700456 2010 The human proteins MBD5 and MBD6 associate with heterochromatin but they do not bind methylated DNA.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16541075 2006 The finished DNA sequence of human chromosome 12.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...