Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute myeloid leukemia -1.400 3.3e-02
adrenocortical carcinoma 1.091 3.9e-03
Breast cancer 2.300 2.8e-02
gastric carcinoma 1.300 3.3e-02
group 3 medulloblastoma 1.100 1.5e-02
intraductal papillary-mucinous carcinoma... 1.100 2.1e-02
invasive ductal carcinoma 1.600 2.9e-02
lung adenocarcinoma 1.200 2.4e-04
lung cancer 1.200 4.9e-02
malignant mesothelioma 1.700 1.3e-07
medulloblastoma, large-cell 1.500 1.5e-04
osteosarcoma -2.003 5.2e-05
ovarian cancer 1.100 8.5e-03

Gene RIF (1)

AA Sequence

MQSTDLGNKESGKIWHRKPSPATRDGIIVNIIHNTSDYHPKVLRFLNVAFDGTGDCLIAGDHQGNIYVFD      1 - 70
LHGNRFNLVQRTAQACTALAFNLRRKSEFLVALADYSIKCFDTVTKELVSWMRGHESSVFSISVHASGKY     71 - 140
AITTSSDTAQLWDLDTFQRKRKLNIRQSVGIQKVFFLPLSNTILSCFKDNSIFAWECDTLFCKYQLPAPP    141 - 210
ESSSILYKVFAVTRDGRILAAGGKSNHLHLWCLEARQLFRIIQMPTKVRAIRHLEFLPDSFDAGSNQVLG    211 - 280
VLSQDGIMRFINMQTCKLLFEIGSLDEGISSSAISPHGRYIASIMENGSLNIYSVQALTQEINKPPPPLV    281 - 350
KVIEDLPKNKLSSSDLKMKVTSGRVQQPAKSRESKMQTRILKQDLTGDFESKKNELPDGLNKKRLQILLK    351 - 420
GYGEYPTKYRMFIWRSLLQLPENHTAFSTLIDKGTHVAFLNLQKKYPIKSRKLLRVLQRTLSALAHWSVI    421 - 490
FSDTPYLPLLAFPFVKLFQNNQLICFEVIATLIINWCQHWFEYFPNPPINILSMIENVLAFHDKELLQHF    491 - 560
IDHDITSQLYAWPLLETVFSEVLTREEWLKLFDNIFSNHPSFLLMTVVAYNICSRTPLLSCNLKDDFEFF    561 - 630
FHHRNNLDINVVIRQVYHLMETTPTDIHPDSMLNVFVALTKGQYPVFNQYPKFIVDYQTQERERIRNDEL    631 - 700
DYLRERQTVEDMQAKVDQQRVEDEAWYQKQELLRKAEETRREMLLQEEEKMIQQRQRLAAVKRELKVKEM    701 - 770
HLQDAARRRFLKLQQDQQEMELRRLDDEIGRKVYMRDREIAATARDLEMRQLELESQKRLYEKNLTENQE    771 - 840
ALAKEMRADADAYRRKVDLEEHMFHKLIEAGETQSQKTQKVIKENLAKAEQACLNTDWQIQSLHKQKCDD    841 - 910
LQRNKCYQEVAKLLRENRRKEIEIINAMVEEEAKKWKEAEGKEFRLRSAKKASALSDASRKWFLKQEINA    911 - 980
AVEHAENPCHKEEPRFQNEQDSSCLPRTSQLNDSSEMDPSTQISLNRRAVEWDTTGQNLIKKVRNLRQRL    981 - 1050
TARARHRCQTPHLLAA                                                         1051 - 1066
//

Text Mined References (7)

PMID Year Title