Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.24
PubTator Score 4.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96DN0 ER protein 27
Symbols PDIA8
C12orf46

Gene

PDB

2L4C   4F9Z  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MEAAPSRFMFLLFLLTCELAAEVAAEVEKSSDGPGAAQEPTWLTDVPAAMEFIAATEVAVIGFFQDLEIP      1 - 70
AVPILHSMVQKFPGVSFGISTDSEVLTHYNITGNTICLFRLVDNEQLNLEDEDIESIDATKLSRFIEINS     71 - 140
LHMVTEYNPVTVIGLFNSVIQIHLLLIMNKASPEYEENMHRYQKAAKLFQGKILFILVDSGMKENGKVIS    141 - 210
FFKLKESQLPALAIYQTLDDEWDTLPTAEVSVEHVQNFCDGFLSGKLLKENRESEGKTPKVEL           211 - 273
//

Text Mined References (12)

PMID Year Title