Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.21
PubTator Score 4.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96DN0 ER protein 27
Symbols PDIA8
C12orf46

Gene

PDB

2L4C   4F9Z  

Gene RIF (4)

PMID Text
23234573 High-resolution NMR studies of structure and dynamics of human ERp27 indicate extensive interdomain flexibility
23192347 ERp27 is able to distinguish between folded and unfolded substrates, only interacting with the latter and presenting them to for catalysis.
18187620 Knockdown of endoplasmic reticulum protein 27 (ERP27) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
16940051 ERp27 is bound by ERp57 both in vitro and in vivo by a similar mechanism by which ERp57 binds calreticulin

AA Sequence

MEAAPSRFMFLLFLLTCELAAEVAAEVEKSSDGPGAAQEPTWLTDVPAAMEFIAATEVAVIGFFQDLEIP      1 - 70
AVPILHSMVQKFPGVSFGISTDSEVLTHYNITGNTICLFRLVDNEQLNLEDEDIESIDATKLSRFIEINS     71 - 140
LHMVTEYNPVTVIGLFNSVIQIHLLLIMNKASPEYEENMHRYQKAAKLFQGKILFILVDSGMKENGKVIS    141 - 210
FFKLKESQLPALAIYQTLDDEWDTLPTAEVSVEHVQNFCDGFLSGKLLKENRESEGKTPKVEL           211 - 273
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23234573 2013 High-resolution NMR studies of structure and dynamics of human ERp27 indicate extensive interdomain flexibility.
23192347 2013 The crystal structure of the protein-disulfide isomerase family member ERp27 provides insights into its substrate binding capabilities.
18802093 2008 The varicellovirus UL49.5 protein blocks the transporter associated with antigen processing (TAP) by inhibiting essential conformational transitions in the 6+6 transmembrane TAP core complex.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16940051 2006 ERp27, a new non-catalytic endoplasmic reticulum-located human protein disulfide isomerase family member, interacts with ERp57.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...