Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.06

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96DM1 A1L487 A8K0C6 Q8N9E8
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MSNPRKRSIPMRDSNTGLEQLLAEDSFDESDFSEIDDSDNFSDSALEADKIRPLSHLESDGKSSTSSDSG      1 - 70
RSMKWSARAMIPRQRYDFTGTPGRKVDVSDITDPLQYFELFFTEELVSKITRETNAQAALLASKPPGPKG     71 - 140
FSRMDKWKDTDNDELKVFFAVMLLQGIVQKPELEMFWSTRPLLDTPYLRQIMTGERFLLLFRCLHFVNNS    141 - 210
SISAGQSKAQISLQKIKPVFDFLVNKFSTVYTPNRNIAVDESLMLFKGPLAMKQYLPTKRVRFGLKLYVL    211 - 280
CESQSGYVWNALVHTGPGMNLKDSADGLKSSRIVLTLVNDLLGQGYCVFLDNFNISPMLFRELHQNRTDA    281 - 350
VGTARLNRKQIPNDLKKRIAKGTTVARFCGELMALKWCDGKEVTMLSTFHNDTVIEVNNRNGKKTKRPRV    351 - 420
IVDYNENMGAVDSADQMLTSYPSERKRHKVWYKKFFHHLLHITVLNSYILFKKDNPEHTMSHINFRLALI    421 - 490
ERMLEKHHKPGQQHLRGRPCSDDVTPLRLSGRHFPKSIPATSGKQNPTGRCKICCSQYDKDGKKIRKETR    491 - 560
YFCAECDVPLCVVPCFEIYHTKKNY                                                 561 - 585
//

Text Mined References (4)

PMID Year Title
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12955498 2003 Molecular evolutionary analysis of the widespread piggyBac transposon family and related "domesticated" sequences.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.