Property Summary

NCBI Gene PubMed Count 17
Grant Count 5
Funding $740,049.53
PubMed Score 397.68
PubTator Score 125.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
group 3 medulloblastoma 1.800 0.000
medulloblastoma, large-cell 1.100 0.000
primitive neuroectodermal tumor 1.100 0.001
lung cancer 1.200 0.038
subependymal giant cell astrocytoma -1.099 0.037
pituitary cancer 1.100 0.000

 GO Function (1)

Gene RIF (2)

PMID Text
27138336 Clinically, low SNRNP40 expression is associated with metastatic relapse.
22174317 HIV-1 Rev interacting protein, small nuclear ribonucleoprotein 40kDa (SNRNP40), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells

AA Sequence

MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIMLLSGHEGEVY      1 - 70
CCKFHPNGSTLASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSET     71 - 140
GERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVTFNDTSDQIIS    141 - 210
GGIDNDIKVWDLRQNKLTYTMRGHADSVTGLSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGN    211 - 280
VHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKR    281 - 350
LYMGEIQ                                                                   351 - 357
//

Text Mined References (21)

PMID Year Title
27138336 2016 Highly variable cancer subpopulations that exhibit enhanced transcriptome variability and metastatic fitness.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
23455491 2013 NKAIN1-SERINC2 is a functional, replicable and genome-wide significant risk gene region specific for alcohol dependence in subjects of European descent.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17041588 2006 CUL4-DDB1 ubiquitin ligase interacts with multiple WD40-repeat proteins and regulates histone methylation.
16723661 2006 The network of protein-protein interactions within the human U4/U6.U5 tri-snRNP.
More...