Property Summary

NCBI Gene PubMed Count 17
PubMed Score 397.68
PubTator Score 125.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 7.22387365335539E-7
group 3 medulloblastoma 2254 2.41408527140823E-5
pituitary cancer 1972 6.87289675084239E-5
medulloblastoma, large-cell 6234 4.79317449986834E-4
primitive neuroectodermal tumor 3031 0.0011564148230275
subependymal giant cell astrocytoma 2287 0.0373003341290978
lung cancer 4473 0.0377395340429753

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
group 3 medulloblastoma 1.800 0.000
medulloblastoma, large-cell 1.100 0.000
primitive neuroectodermal tumor 1.100 0.001
lung cancer 1.200 0.038
subependymal giant cell astrocytoma -1.099 0.037
pituitary cancer 1.100 0.000

Synonym

Accession Q96DI7 B4DQJ1 O75938 O95320 U5 snRNP 40 kDa protein
Symbols 40K
SPF38
WDR57
PRP8BP
HPRP8BP
PRPF8BP

Gene

PDB

3JCR  

  Ortholog (11)

 GO Function (1)

Gene RIF (2)

PMID Text
27138336 Clinically, low SNRNP40 expression is associated with metastatic relapse.
22174317 HIV-1 Rev interacting protein, small nuclear ribonucleoprotein 40kDa (SNRNP40), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells

AA Sequence

MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIMLLSGHEGEVY      1 - 70
CCKFHPNGSTLASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSET     71 - 140
GERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVTFNDTSDQIIS    141 - 210
GGIDNDIKVWDLRQNKLTYTMRGHADSVTGLSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGN    211 - 280
VHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKR    281 - 350
LYMGEIQ                                                                   351 - 357
//

Text Mined References (21)

PMID Year Title
27138336 2016 Highly variable cancer subpopulations that exhibit enhanced transcriptome variability and metastatic fitness.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
23455491 2013 NKAIN1-SERINC2 is a functional, replicable and genome-wide significant risk gene region specific for alcohol dependence in subjects of European descent.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17041588 2006 CUL4-DDB1 ubiquitin ligase interacts with multiple WD40-repeat proteins and regulates histone methylation.
16723661 2006 The network of protein-protein interactions within the human U4/U6.U5 tri-snRNP.
More...