Property Summary

NCBI Gene PubMed Count 48
PubMed Score 47.46
PubTator Score 36.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

Protein-protein Interaction (4)

Gene RIF (38)

AA Sequence

MEANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFA      1 - 70
DPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAM     71 - 140
LMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGLPYTMDAF    141 - 210
MLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAAAVAAARGSGSNPARPGGFPGANSPG    211 - 280
PVADLYGPASQDSGVGNYISAASPQPGSGFGHGIAGPLIATAFTNGYH                          281 - 328
//

Text Mined References (54)

PMID Year Title