Property Summary

NCBI Gene PubMed Count 34
Grant Count 15
R01 Count 9
Funding $821,285.4
PubMed Score 40.74
PubTator Score 36.49

Knowledge Summary

Patent

No data available

Expression

Gene RIF (24)

PMID Text
27121842 MSI2 directly attenuates aryl hydrocarbon receptor (AHR) signalling through post-transcriptional downregulation of canonical AHR pathway components in cord blood haematopoietic stem and progenitor cells
26673327 Concomitant loss of function of both MSI1 is sufficient to abrogate the growth of human colorectal cancer cells, and Msi gene deletion inhibits tumorigenesis in several mouse models of intestinal cancer.
25851660 This review highlights both the essential contribution of RBPs to posttranscriptional regulation and the importance of the Musashi family as master regulators of male gamete development--{REVIEW}
25774828 the MSI2 RNA-binding protein has a role in transformation of intestinal epithelium
25664853 MSI2 controls efficient translation of the oncogenic leukemic stem cell self-renewal program.
25449073 Acute myeloid leukemia patients have a higher level of MSI2 gene expression.
25380226 Msi proteins contribute to an epithelial gene expression program in neural and mammary cell types.
25363400 Up-regulated MSI2 is associated with more aggressive chronic myeloid leukemia.
25090928 These results confirm the association of MSI2 expression with outcome in adult B-ALL and demonstrate the utility of MSI2 as a clinical prognostic biomarker.
24305552 MSI2 correlates with epithelial-mesenchymal transition and has the potential to be a new predictive biomarker of hepatocellular carcinoma prognosis and invasion.
More...

AA Sequence

MEANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFA      1 - 70
DPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAM     71 - 140
LMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGLPYTMDAF    141 - 210
MLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAAAVAAARGSGSNPARPGGFPGANSPG    211 - 280
PVADLYGPASQDSGVGNYISAASPQPGSGFGHGIAGPLIATAFTNGYH                          281 - 328
//

Text Mined References (40)

PMID Year Title
27121842 2016 Musashi-2 attenuates AHR signalling to expand human haematopoietic stem cells.
26673327 2015 The Msi Family of RNA-Binding Proteins Function Redundantly as Intestinal Oncoproteins.
25851660 RNA binding proteins in spermatogenesis: an in depth focus on the Musashi family.
25774828 2015 Transformation of the intestinal epithelium by the MSI2 RNA-binding protein.
25664853 2015 Musashi2 sustains the mixed-lineage leukemia-driven stem cell regulatory program.
25449073 2014 [Expression of Musashi2 gene in de novo acute myeloid leukemia and its clinical implications].
25416956 2014 A proteome-scale map of the human interactome network.
25380226 2014 Musashi proteins are post-transcriptional regulators of the epithelial-luminal cell state.
25363400 2015 Up-regulated MSI2 is associated with more aggressive chronic myeloid leukemia.
25090928 2015 Prognostic significance of MSI2 predicts unfavorable outcome in adult B-acute lymphoblastic leukemia.
More...