Property Summary

NCBI Gene PubMed Count 9
PubMed Score 78.24
PubTator Score 45.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 4.5e-05
chronic rhinosinusitis -1.320 8.3e-03
cystic fibrosis 1.061 9.0e-05
Duchenne muscular dystrophy -1.298 1.3e-06
interstitial cystitis -1.400 1.0e-03
intraductal papillary-mucinous adenoma (... 1.700 7.9e-05
intraductal papillary-mucinous neoplasm ... 1.300 8.0e-03
lung carcinoma 1.700 1.8e-20
ovarian cancer -2.100 3.0e-04
pituitary cancer -1.200 2.6e-03
psoriasis -1.200 1.1e-06
subependymal giant cell astrocytoma 1.960 2.3e-02
ulcerative colitis -1.700 1.6e-05

Gene RIF (1)

AA Sequence

MANEAYPCPCDIGHRLEYGGLGREVQVEHIKAYVTKSPVDAGKAVIVIQDIFGWQLPNTRYIADMISGNG      1 - 70
YTTIVPDFFVGQEPWDPSGDWSIFPEWLKTRNAQKIDREISAILKYLKQQCHAQKIGIVGFCWGGTAVHH     71 - 140
LMMKYSEFRAGVSVYGIVKDSEDIYNLKNPTLFIFAENDVVIPLKDVSLLTQKLKEHCKVEYQIKTFSGQ    141 - 210
THGFVHRKREDCSPADKPYIDEARRNLIEWLNKYM                                       211 - 245
//

Text Mined References (15)

PMID Year Title