Property Summary

NCBI Gene PubMed Count 21
PubMed Score 288.09
PubTator Score 104.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (4)

Disease log2 FC p
ovarian cancer 1.100 1.2e-04
group 3 medulloblastoma 1.200 1.4e-02
malignant mesothelioma 1.100 2.7e-05
osteosarcoma -2.787 8.8e-10

Gene RIF (2)

AA Sequence

METPGASASSLLLPAASRPPRKREAGEAGAATSKQRVLDEEEYIEGLQTVIQRDFFPDVEKLQAQKEYLE      1 - 70
AEENGDLERMRQIAIKFGSALGKMSREPPPPYVTPATFETPEVHAGTGVVGNKPRPRGRGLEDGEAGEEE     71 - 140
EKEPLPSLDVFLSRYTSEDNASFQEIMEVAKERSRARHAWLYQAEEEFEKRQKDNLELPSAEHQAIESSQ    141 - 210
ASVETWKYKAKNSLMYYPEGVPDEEQLFKKPRQVVHKNTRFLRDPFSQALSRCQLQQAAALNAQHKQGKV    211 - 280
GPDGKELIPQESPRVGGFGFVATPSPAPGVNESPMMTWGEVENTPLRVEGSETPYVDRTPGPAFKILEPG    281 - 350
RRERLGLKMANEAAAKNRAKKQEALRRVTENLASLTPKGLSPAMSPALQRLVSRTASKYTDRALRASYTP    351 - 420
SPARSTHLKTPASGLQTPTSTPAPGSATRTPLTQDPASITDNLLQLPARRKASDFF                  421 - 476
//

Text Mined References (26)

PMID Year Title