Property Summary

NCBI Gene PubMed Count 12
Grant Count 1
Funding $59,169.2
PubMed Score 11.95
PubTator Score 4.61

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96DE5 APC16
Symbols MSAG
APC16
CENP-27
C10orf104
bA570G20.3

Gene

 Grant Application (1)

PDB

4UI9   5A31   5G04   5G05   5KHR   5L9U   5LCW   4RG6   4RG9  

Gene RIF (2)

PMID Text
25490258 The structures show how one APC16 binds asymmetrically to the symmetric APC3 dimer and, together with biochemistry and prior data, explain how APC16 recruits APC7 to APC3.
19232044 The predicted protein encoded by MSAG contains 110 amino acids and has a theoretical molecular weight of 11667.04 and an isoelectric point of 4.91 (MSAG).

AA Sequence

MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQV      1 - 70
KHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTPSSG                                   71 - 110
//

Text Mined References (15)

PMID Year Title
25490258 2015 Structure of an APC3-APC16 complex: insights into assembly of the anaphase-promoting complex/cyclosome.
25043029 2014 Molecular architecture and mechanism of the anaphase-promoting complex.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20813266 2010 The protein composition of mitotic chromosomes determined using multiclassifier combinatorial proteomics.
20360068 2010 Systematic analysis of human protein complexes identifies chromosome segregation proteins.
19232044 2009 Identification of a novel gene, MSAG, regulated by high levels of glucose and insulin.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
More...