Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.95
PubTator Score 4.61

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

PDB (11)

Gene RIF (2)

AA Sequence

MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQV      1 - 70
KHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTPSSG                                   71 - 110
//

Text Mined References (15)

PMID Year Title