Property Summary

NCBI Gene PubMed Count 16
PubMed Score 97.19
PubTator Score 22.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.100 2.6e-02
Endometriosis -1.440 5.7e-03
ependymoma -1.500 2.7e-02
group 3 medulloblastoma -1.200 5.9e-03
intraductal papillary-mucinous neoplasm ... 1.600 3.2e-03
lung adenocarcinoma -1.500 3.4e-16
medulloblastoma, large-cell -2.700 2.9e-03
oligodendroglioma -1.700 4.9e-02
osteosarcoma -1.170 1.4e-03
pancreatic ductal adenocarcinoma liver m... -1.333 8.3e-03
tuberculosis 2.000 1.2e-05

Gene RIF (7)

AA Sequence

MAGARRLELGEALALGSGWRHACHALLYAPDPGMLFGRIPLRYAILMQMRFDGRLGFPGGFVDTQDRSLE      1 - 70
DGLNRELREELGEAAAAFRVERTDYRSSHVGSGPRVVAHFYAKRLTLEELLAVEAGATRAKDHGLEVLGL     71 - 140
VRVPLYTLRDGVGGLPTFLENSFIGSAREQLLEALQDLGLLQSGSISGLKIPAHH                   141 - 195
//

Text Mined References (20)

PMID Year Title