Property Summary

NCBI Gene PubMed Count 16
PubMed Score 96.49
PubTator Score 22.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.100 0.026
ependymoma -1.500 0.027
oligodendroglioma -1.700 0.049
osteosarcoma -1.170 0.001
medulloblastoma -1.600 0.006
medulloblastoma, large-cell -2.700 0.003
pancreatic ductal adenocarcinoma liver m... -1.333 0.008
tuberculosis 2.100 0.000
intraductal papillary-mucinous neoplasm ... 1.600 0.003
lung adenocarcinoma -1.500 0.000
Endometriosis -1.440 0.006

Synonym

Accession Q96DE0 B4E3B4 E9PED4 F5GYJ1 Q96N82
Symbols

Gene

PDB

2XSQ   3COU   3MGM  

Gene RIF (7)

PMID Text
26121039 This study details structural and regulatory mechanisms explaining how substrates are selected for hydrolysis by human NUDT16.
26038567 The RNA decapping enzyme NUDT16 selectively degrades 5'-TOP mRNAs during Rift Valley fever virus infection and this decay is triggered in response to mTOR attenuation via the translational repressor 4EBP1/2 axis.
21337011 hNUDT16 can also actively cleave the mGDP cap from mRNAs in the presence of Mg(2)(+) or Mn(2)(+).
21070968 Like Dcp2, Nudt16 also regulates the stability of a subset of mRNAs including a member of the motin family of proteins involved in angiogenesis.
20385596 NUDT16 is a (deoxy)inosine diphosphatase that may function mainly in the nucleus to protect cells from deleterious effects of (d)ITP.
18607096 Recombinant NUDT16, a decapping enzyme, has been crystallized. NUDT16 plays a pivotal role in U8 snoRNA stability.
17567574 X29/H29K may be the nuclear counterparts of the cytoplasmic decapping machinery, localized in specialized bodies involved in RNA decay

AA Sequence

MAGARRLELGEALALGSGWRHACHALLYAPDPGMLFGRIPLRYAILMQMRFDGRLGFPGGFVDTQDRSLE      1 - 70
DGLNRELREELGEAAAAFRVERTDYRSSHVGSGPRVVAHFYAKRLTLEELLAVEAGATRAKDHGLEVLGL     71 - 140
VRVPLYTLRDGVGGLPTFLENSFIGSAREQLLEALQDLGLLQSGSISGLKIPAHH                   141 - 195
//

Text Mined References (20)

PMID Year Title
26121039 2015 Structural Basis for the Specificity of Human NUDT16 and Its Regulation by Inosine Monophosphate.
26038567 2015 Virus-induced translational arrest through 4EBP1/2-dependent decay of 5'-TOP mRNAs restricts viral infection.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21337011 2011 hNUDT16: a universal decapping enzyme for small nucleolar RNA and cytoplasmic mRNA.
21269460 2011 Initial characterization of the human central proteome.
21070968 2010 Multiple mRNA decapping enzymes in mammalian cells.
20385596 2010 NUDT16 is a (deoxy)inosine diphosphatase, and its deficiency induces accumulation of single-strand breaks in nuclear DNA and growth arrest.
20081199 2010 NUDT16 and ITPA play a dual protective role in maintaining chromosome stability and cell growth by eliminating dIDP/IDP and dITP/ITP from nucleotide pools in mammals.
18820299 2008 Evolutionary conservation supports ancient origin for Nudt16, a nuclear-localized, RNA-binding, RNA-decapping enzyme.
More...