Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
cystic fibrosis -2.347 5.0e-06
hereditary spastic paraplegia -1.221 8.5e-03
non diabetic and post-ischemic heart fai... 1.200 1.1e-02

Gene RIF (2)

AA Sequence

MTENVVCTGAVNAVKEVWEKRIKKLNEDLKREKEFQHKLVRIWEERVSLTKLREKVTREDGRVILKIEKE      1 - 70
EWKTLPSSLLKLNQLQEWQLHRTGLLKIPEFIGRFQNLIVLDLSRNTISEIPPGIGLLTRLQELILSYNK     71 - 140
IKTVPKELSNCASLEKLELAVNRDICDLPQELSNLLKLTHLDLSMNDFTTIPLAVLNMPALEWLDMGSNK    141 - 210
LEQLPDTIERMQNLHTLWLQRNEITCLPQTISNMKNLGTLVLSNNKLQDIPVCMEEMANLRFVNFRDNPL    211 - 280
KLKVSLPPSEGTDEEEERELFGLQFMHTYIQESRRRADHQVNGSTTLPISINTDG                   281 - 335
//

Text Mined References (10)

PMID Year Title