Property Summary

NCBI Gene PubMed Count 17
PubMed Score 11.00
PubTator Score 10.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 2.5e-08
psoriasis 6694 1.6e-05
malignant mesothelioma 3232 1.9e-05
ovarian cancer 8520 1.1e-04
Atopic dermatitis 952 2.4e-03
active ulcerative colitis 764 4.0e-02

Expression

  Differential Expression (6)

Disease log2 FC p
active ulcerative colitis 1.145 4.0e-02
Atopic dermatitis -1.100 2.4e-03
malignant mesothelioma -1.400 1.9e-05
osteosarcoma 1.726 2.5e-08
ovarian cancer -1.300 1.1e-04
psoriasis 1.300 1.6e-05

Synonym

Accession Q96DC9 Q6IA10 Q9H6T1
Symbols OTB2
OTU2
C14orf137

Gene

PANTHER Protein Class (2)

PDB

4FJV   1TFF  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSRE      1 - 70
IFKFKERVLQTPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTS     71 - 140
AFIRNRADFFRHFIDEEMDIKDFCTHEVEPMATECDHIQITALSQALSIALQVEYVDEMDTALNHHVFPE    141 - 210
AATPSVYLLYKTSHYNILYAADKH                                                  211 - 234
//

Text Mined References (17)

PMID Year Title