Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.55
PubTator Score 10.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
psoriasis 2.200 0.000
osteosarcoma 1.726 0.000
Atopic dermatitis -1.100 0.002
active ulcerative colitis 1.145 0.040
ovarian cancer -1.300 0.000

Gene RIF (4)

PMID Text
24560272 OTUB2 fine-tunes the speed of double-strand break-induced ubiquitination so that the appropriate DNA repair pathway is chosen
23515685 OTUB2 is a novel promoter of viability and insulin secretion in human beta cells. OTUB2 acts through the inhibition of NF-kappaB signalling.
19996094 Findings suggest that OTUB1 and OTUB2 negatively regulate virus-triggered type I IFN induction and cellular antiviral response by deubiquitinating TRAF3 and -6.
15258613 Data report the first crystal structure of an OTU superfamily protein, otubain 2, at 2.1 A resolution and propose a model for otubain-ubiquitin binding.

AA Sequence

MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSRE      1 - 70
IFKFKERVLQTPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTS     71 - 140
AFIRNRADFFRHFIDEEMDIKDFCTHEVEPMATECDHIQITALSQALSIALQVEYVDEMDTALNHHVFPE    141 - 210
AATPSVYLLYKTSHYNILYAADKH                                                  211 - 234
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24560272 2014 Fine-tuning of DNA damage-dependent ubiquitination by OTUB2 supports the DNA repair pathway choice.
23827681 2013 OTU deubiquitinases reveal mechanisms of linkage specificity and enable ubiquitin chain restriction analysis.
23515685 2013 Otubain 2 is a novel promoter of beta cell survival as revealed by siRNA high-throughput screens of human pancreatic islets.
21630459 2011 Proteomic characterization of the human sperm nucleus.
19996094 2010 Regulation of virus-triggered signaling by OTUB1- and OTUB2-mediated deubiquitination of TRAF3 and TRAF6.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
18954305 2009 Structural basis and specificity of human otubain 1-mediated deubiquitination.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...