Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.80
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute quadriplegic myopathy 1.349 6.3e-05
adrenocortical adenoma -1.444 1.2e-02
adrenocortical carcinoma -2.407 1.4e-05
aldosterone-producing adenoma -1.480 1.4e-02
astrocytic glioma -1.100 5.0e-02
atypical teratoid / rhabdoid tumor 1.200 4.5e-05
colon cancer -1.300 3.0e-02
cystic fibrosis -1.247 2.8e-04
ductal carcinoma in situ -2.800 1.2e-04
ependymoma 1.500 8.1e-11
esophageal adenocarcinoma -1.500 1.8e-02
group 3 medulloblastoma 1.700 3.0e-05
intraductal papillary-mucinous adenoma (... -2.400 5.4e-04
intraductal papillary-mucinous carcinoma... -2.400 1.2e-03
intraductal papillary-mucinous neoplasm ... -2.800 3.7e-03
invasive ductal carcinoma -1.900 2.0e-02
lung adenocarcinoma -1.300 7.6e-04
lung carcinoma 1.100 2.5e-17
malignant mesothelioma -4.800 2.0e-09
nephrosclerosis -1.218 8.3e-03
pancreatic cancer -1.300 2.8e-05
pancreatic ductal adenocarcinoma liver m... -2.986 1.5e-03
pituitary cancer -1.200 7.3e-03

Gene RIF (3)

AA Sequence

MAAVAVLRAFGASGPMCLRRGPWAQLPARFCSRDPAGAGRRESEPRPTSARQLDGIRNIVLSNPKKRNAL      1 - 70
SLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDYHAEVFQTCSKVMMHIRNHPV     71 - 140
PVIAMVNGLAAAAGCQLVASCDIAVASDKSSFATPGVNVGLFCSTPGVALARAVPRKVALEMLFTGEPIS    141 - 210
AQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKATFYKQLPQDLGTAYYLTSQAMVDNLAL    211 - 280
RDGQEGITAFLQKRKPVWSHEPV                                                   281 - 303
//

Text Mined References (13)

PMID Year Title