Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.65
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 2.54369332919215E-17
posterior fossa group A ependymoma 1511 1.88246832929324E-14
malignant mesothelioma 3163 1.96390241535355E-9
atypical teratoid/rhabdoid tumor 1095 3.54549235040555E-7
adrenocortical carcinoma 1427 1.41352635160348E-5
group 3 medulloblastoma 2254 2.97328399723325E-5
acute quadriplegic myopathy 1157 6.29455947556628E-5
ductal carcinoma in situ 1745 1.22517633954811E-4
cystic fibrosis 1670 2.80854269468479E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 5.37051941281025E-4
lung adenocarcinoma 2714 7.58021025698042E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00118641211756099
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00153578346031173
pancreatic cancer 2300 0.00167849974073518
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00371079704990415
pituitary cancer 1972 0.00734900165487962
colon cancer 1475 0.00814087285218498
nephrosclerosis 329 0.0083168523950579
adrenocortical adenoma 134 0.0122334352405591
aldosterone-producing adenoma 664 0.0137418809313139
esophageal adenocarcinoma 737 0.0180659511873377
invasive ductal carcinoma 2950 0.0202677657587822
astrocytic glioma 2241 0.0499762104821127

Expression

Synonym

Accession Q96DC8 Q53HR9 Q5W0J7 Q8WYY8 Q9BVL8 Q9H7G4
Symbols

Gene

PANTHER Protein Class (2)

PDB

2VX2  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAVAVLRAFGASGPMCLRRGPWAQLPARFCSRDPAGAGRRESEPRPTSARQLDGIRNIVLSNPKKRNAL      1 - 70
SLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDYHAEVFQTCSKVMMHIRNHPV     71 - 140
PVIAMVNGLAAAAGCQLVASCDIAVASDKSSFATPGVNVGLFCSTPGVALARAVPRKVALEMLFTGEPIS    141 - 210
AQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKATFYKQLPQDLGTAYYLTSQAMVDNLAL    211 - 280
RDGQEGITAFLQKRKPVWSHEPV                                                   281 - 303
//

Text Mined References (11)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24162737 2013 Meta-analysis of 74,046 individuals identifies 11 new susceptibility loci for Alzheimer's disease.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...