Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.300 6.6e-03
atypical teratoid / rhabdoid tumor -1.100 1.0e-03
cystic fibrosis -1.100 1.2e-04
ependymoma -2.200 1.8e-02
glioblastoma -1.400 6.7e-05
group 3 medulloblastoma 1.300 5.6e-04
intraductal papillary-mucinous neoplasm ... 1.500 8.9e-03
lung cancer 1.700 2.2e-03
medulloblastoma, large-cell -1.700 2.6e-06
oligodendroglioma -2.300 8.5e-03
osteosarcoma -5.574 4.1e-15
psoriasis -3.000 5.8e-05

Gene RIF (4)

AA Sequence

MWSRRQGRLRPTVCGVEELRRRRREREAALRKARREQQLVSKRLLRNDAPEEAGEGCVAAILGETEVQQF      1 - 70
LRQAQRGTEEKEREGALVSLRRGLQHPETQQTFIRLEGSMRTLVGLLTSNQALLQLEAARCLHELSHSEQ     71 - 140
STVAEACLPATSYLLTYLSSHSSDFIELCLYTLGNLIVESEAVRRQLLPQGIVPALAACIQSPHVAVLEA    141 - 210
LGYALSQLLQAEEAPEKIIPSILASTLPQHMLQMLQPGPKLNPGVAVEFAWCLHYIICSQVSNPLLIGHG    211 - 280
ALSTLGLLLLDLAGAVQKTEDAGLELLACPVLRCLSNLLTEAAVETVGGQMQLRDERVVAALFILLQFFF    281 - 350
QKQPSLLPEGLWLLNNLTANSPSFCTSLLSLDLIEPLLQLLPVSNVVSVMVLTVLCNVAEKGPAYCQRLW    351 - 420
PGPLLPALLHTLAFSDTEVVGQSLELLHLLFLYQPEAVQVFLQQSGLQALERHQEEAQLQDRVYALQQTA    421 - 490
LQG                                                                       491 - 493
//

Text Mined References (10)

PMID Year Title