Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 4.12847586774367E-15
medulloblastoma, large-cell 6234 2.56894355393272E-6
psoriasis 6685 5.82325677507808E-5
glioblastoma 5572 6.74324933017172E-5
cystic fibrosis 1670 1.18966080237098E-4
group 3 medulloblastoma 2254 5.6216041650043E-4
atypical teratoid / rhabdoid tumor 4369 0.00103958698090116
lung cancer 4473 0.00223050627401959
astrocytic glioma 2241 0.00663110125386238
oligodendroglioma 2849 0.00851258385205531
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00889953120704455
ependymoma 2514 0.0179533502182406

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.300 0.007
ependymoma -2.200 0.018
oligodendroglioma -2.300 0.009
psoriasis -3.000 0.000
osteosarcoma -5.574 0.000
atypical teratoid / rhabdoid tumor -1.100 0.001
glioblastoma -1.400 0.000
group 3 medulloblastoma 1.300 0.001
medulloblastoma, large-cell -1.700 0.000
intraductal papillary-mucinous neoplasm ... 1.500 0.009
lung cancer 1.700 0.002
cystic fibrosis -1.100 0.000

Synonym

Accession Q96DC7 Q9BUU0 Q9P198
Symbols PRO1580

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (4)

PMID Text
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19729601 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MWSRRQGRLRPTVCGVEELRRRRREREAALRKARREQQLVSKRLLRNDAPEEAGEGCVAAILGETEVQQF      1 - 70
LRQAQRGTEEKEREGALVSLRRGLQHPETQQTFIRLEGSMRTLVGLLTSNQALLQLEAARCLHELSHSEQ     71 - 140
STVAEACLPATSYLLTYLSSHSSDFIELCLYTLGNLIVESEAVRRQLLPQGIVPALAACIQSPHVAVLEA    141 - 210
LGYALSQLLQAEEAPEKIIPSILASTLPQHMLQMLQPGPKLNPGVAVEFAWCLHYIICSQVSNPLLIGHG    211 - 280
ALSTLGLLLLDLAGAVQKTEDAGLELLACPVLRCLSNLLTEAAVETVGGQMQLRDERVVAALFILLQFFF    281 - 350
QKQPSLLPEGLWLLNNLTANSPSFCTSLLSLDLIEPLLQLLPVSNVVSVMVLTVLCNVAEKGPAYCQRLW    351 - 420
PGPLLPALLHTLAFSDTEVVGQSLELLHLLFLYQPEAVQVFLQQSGLQALERHQEEAQLQDRVYALQQTA    421 - 490
LQG                                                                       491 - 493
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
19729601 2009 Candidate gene polymorphisms for ischemic stroke.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.