Property Summary

NCBI Gene PubMed Count 40
PubMed Score 427.60
PubTator Score 63.15

Knowledge Summary

Patent (14,029)

Expression

  Differential Expression (16)

Disease log2 FC p
active ulcerative colitis 2.201 4.8e-03
astrocytoma 1.700 2.8e-02
colon cancer 1.400 1.1e-05
gastric carcinoma 1.400 3.0e-02
glioblastoma 2.000 2.2e-02
intraductal papillary-mucinous neoplasm ... 1.100 1.0e-02
lung cancer -1.300 2.3e-03
Multiple myeloma 1.537 3.6e-03
osteosarcoma -1.003 2.3e-02
ovarian cancer -1.200 1.0e-04
pancreatic cancer 1.600 1.8e-04
pancreatic ductal adenocarcinoma liver m... 1.969 1.0e-02
pediatric high grade glioma 1.100 9.9e-03
Rheumatoid arthritis -1.200 4.1e-02
spina bifida 1.010 4.1e-02
subependymal giant cell astrocytoma 1.600 8.1e-03

Gene RIF (30)

AA Sequence

MSPSGRLCLLTIVGLILPTRGQTLKDTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQ      1 - 70
PQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEH     71 - 140
TLRKRGLLVAAVLFITGIIILTSGKCRQLSRLCRNRCR                                    141 - 178
//

Text Mined References (41)

PMID Year Title