Property Summary

NCBI Gene PubMed Count 37
Grant Count 74
R01 Count 9
Funding $18,563,581.52
PubMed Score 399.06
PubTator Score 63.15

Knowledge Summary

Patent (14,029)

Expression

  Differential Expression (16)

Disease log2 FC p
Rheumatoid Arthritis -1.200 0.041
Multiple myeloma 1.537 0.004
osteosarcoma -1.678 0.000
astrocytoma 1.700 0.028
glioblastoma 2.000 0.022
pancreatic ductal adenocarcinoma liver m... 1.999 0.006
intraductal papillary-mucinous neoplasm ... 1.100 0.010
lung cancer -1.300 0.002
colon cancer 1.400 0.000
active ulcerative colitis 2.251 0.005
pancreatic cancer 1.600 0.000
pediatric high grade glioma 1.100 0.010
subependymal giant cell astrocytoma 1.729 0.009
spina bifida 1.010 0.041
gastric carcinoma 1.500 0.022
ovarian cancer 1.400 0.000

Synonym

Accession Q96DB9 B7WNZ8 Q6UW44 Q9HC34 Q9P039
Symbols RIC
IWU1
KCT1
OIT2
DYSAD
HSPC113
PRO6241

Gene

Gene RIF (28)

PMID Text
26458963 Dysadherin-silenced side population cells exhibited reduced expression of Bcl-2 and Bax compared with that prior to silencing.
26410457 Study demonstrated that the expression of FXYD1, FXYD3 and FXYD5 is elevated in the lungs of Acute respiratory distress syndrome patients
22965940 These results suggest a role of let-7a down-regulation in the development of thyroid neoplasias of the follicular histotype, likely regulating dysadherin protein expression levels.
22494103 Findings suggest that dysadherin might contribute to breast cancer progression through AKT activation.
22105147 we are focusing on the role of dysadherin in E-cadherin downregulation, the various expression patterns of the molecule in head and neck cancer
21809991 Overexpression of Snail, Slug, and dysadherin and activation of Wnt and PI3K/Akt signaling was associated with inactivated E-cadherin in the spindle cells of monophasic fibrous synovial sarcomas.
21774927 This is the first report on expression of dysadherin in the male gonad and in spermatozoa.
21328336 Data show that osteoblasts are the major cell type of the bone marrow that affect RCC cells by secreting factors that increase the expression of dysadherin and CCL2 in the tumor cells leading to enhanced cell migration.
21239043 Combined dysadherin-positive expression and E-cadherin-negative expression may be valuable information for predicting aggressive tumor behavior of differentiated-type gastric carcinoma with submucosal invasion
20952084 transfection of dysadherin cDNA into the liver cancer cell line PLC/PRF/5 enhanced the properties of cencer stem cells, including anti-apoptosis, their sphere-forming ability, side population phenotype, and tumor initiation ability in vivo
More...

AA Sequence

MSPSGRLCLLTIVGLILPTRGQTLKDTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQ      1 - 70
PQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEH     71 - 140
TLRKRGLLVAAVLFITGIIILTSGKCRQLSRLCRNRCR                                    141 - 178
//

Text Mined References (38)

PMID Year Title
26458963 2015 Aberrantly regulated dysadherin and B-cell lymphoma 2/B-cell lymphoma 2-associated X enhances tumorigenesis and DNA targeting drug resistance of liver cancer stem cells.
26410457 2016 FXYD1 negatively regulates Na(+)/K(+)-ATPase activity in lung alveolar epithelial cells.
24717576 2014 Modulation of cell polarization by the Na+-K+-ATPase-associated protein FXYD5 (dysadherin).
22965940 2012 Let-7a down-regulation plays a role in thyroid neoplasias of follicular histotype affecting cell adhesion and migration through its ability to target the FXYD5 (Dysadherin) gene.
22494103 2012 Dysadherin expression promotes the motility and survival of human breast cancer cells by AKT activation.
22105147 2012 Role of the recently identified dysadherin in E-cadherin adhesion molecule downregulation in head and neck cancer.
21809991 2011 Immunohistochemical study of correlation between histologic subtype and expression of epithelial-mesenchymal transition-related proteins in synovial sarcomas.
21774927 2011 Expression of dysadherin in the human male reproductive tract and in spermatozoa.
21328336 2012 Osteoblast-secreted factors enhance the expression of dysadherin and CCL2-dependent migration of renal carcinoma cells.
21239043 2011 Significance of dysadherin and E-cadherin expression in differentiated-type gastric carcinoma with submucosal invasion.
More...