Property Summary

NCBI Gene PubMed Count 25
PubMed Score 160.59
PubTator Score 45.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.05796990486331E-9
medulloblastoma 1524 1.6025527009179E-8
pediatric high grade glioma 2712 3.84756924478665E-7
osteosarcoma 7933 1.11018549004665E-6
medulloblastoma, large-cell 6234 1.65812128729278E-6
malignant mesothelioma 3163 4.22015970486567E-6
glioblastoma 5572 5.77437683276799E-6
pilocytic astrocytoma 3086 2.26096926189333E-5
primitive neuroectodermal tumor 3031 7.79360905687081E-4
ependymoma 2514 0.0394237174815073

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
ependymoma -1.400 0.039
glioblastoma -1.800 0.000
osteosarcoma 1.471 0.000
medulloblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -2.000 0.000
medulloblastoma, large-cell -2.800 0.000
primitive neuroectodermal tumor -1.500 0.001
pediatric high grade glioma -1.700 0.000
pilocytic astrocytoma -1.300 0.000

Synonym

Accession Q96DB2 B4DDK1 Q9H6I7 Q9H6X3 Q9NTC9 HD11
Symbols HD11

Gene

PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

Gene RIF (10)

PMID Text
23024001 High HDAC11 expression is associated with neoplasms.
21806350 Data indicate a pronounced deregulation of HDAC genes HDAC9 and HDAC11 in patients with Philadelphia-negative chronic myeloproliferative neoplasms: essential thrombocythemia (ET), polycythemia vera (PV) and primary myelofibrosis (PMF).
21239696 These results demonstrate for the first time that HDAC11 plays an essential role in regulating OX40L expression.
20980834 HDAC11 associates with replication origins inhibits Cdt1-induced re-replication and suppresses MCM loading.
20467334 We found a reduction of HDAC 11 mRNA and increased HDAC 2 levels in amyotrophic lateral sclerosis brain and spinal cord compared with controls.
19276081 Cdt1 undergoes acetylation and is reversibly deacetylated by HDAC11
19011628 HDAC11 negatively regulated expression of the gene encoding interleukin 10 in antigen-presenting cells.
17201809 the absence of tumour-specific somatic events in WNT7A and HDAC11 suggests that these genes are unlikely to have a classical tumour suppressor gene role in sporadic malignant pancreatic endocrine tumours
16142391 Fluorescence in situ hybridization analysis localized HDAC11 gene to chromosome 3p25, a region characterized by frequent gains and losses of chromosomal material in a number of various types of cancer.
11948178 cloning and functional characterization

AA Sequence

MLHTTQLYQHVPETRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVINFLKEEKLLSDSMLVEAREASEED      1 - 70
LLVVHTRRYLNELKWSFAVATITEIPPVIFLPNFLVQRKVLRPLRTQTGGTIMAGKLAVERGWAINVGGG     71 - 140
FHHCSSDRGGGFCAYADITLAIKFLFERVEGISRATIIDLDAHQGNGHERDFMDDKRVYIMDVYNRHIYP    141 - 210
GDRFAKQAIRRKVELEWGTEDDEYLDKVERNIKKSLQEHLPDVVVYNAGTDILEGDRLGGLSISPAGIVK    211 - 280
RDELVFRMVRGRRVPILMVTSGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTPLLPPAVP       281 - 347
//

Text Mined References (27)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23024001 2013 HDAC11 is a novel drug target in carcinomas.
21806350 2012 Increased gene expression of histone deacetylases in patients with Philadelphia-negative chronic myeloproliferative neoplasms.
21239696 2011 HDAC11 plays an essential role in regulating OX40 ligand expression in Hodgkin lymphoma.
20980834 2010 Chromatin unfolding by Cdt1 regulates MCM loading via opposing functions of HBO1 and HDAC11-geminin.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20467334 2010 Differential histone deacetylase mRNA expression patterns in amyotrophic lateral sclerosis.
19276081 2009 Acetylation/deacetylation modulates the stability of DNA replication licensing factor Cdt1.
19088734 2009 From immunity to tolerance through HDAC.
19011628 2009 The histone deacetylase HDAC11 regulates the expression of interleukin 10 and immune tolerance.
More...