Property Summary

NCBI Gene PubMed Count 17
PubMed Score 22.51
PubTator Score 12.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
3-Methylglutaconic Aciduria, Type V 1 0.0 0.0
Disease Target Count P-value
medulloblastoma, large-cell 6241 4.0e-04
Disease Target Count Z-score Confidence
3-methylglutaconic aciduria type 5 3 0.0 5.0
Disease Target Count Z-score Confidence
Cardiomyopathy 116 0.0 4.0
Disease Target Count
3-Methylglutaconic Aciduria, Type 5 1

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell -1.200 4.0e-04

Gene RIF (5)

AA Sequence

MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVS      1 - 70
PTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK                             71 - 116
//

Text Mined References (24)

PMID Year Title