Property Summary

NCBI Gene PubMed Count 29
PubMed Score 18.57
PubTator Score 12.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.500 5.6e-04
astrocytic glioma -1.900 1.4e-02
atypical teratoid / rhabdoid tumor -2.200 6.3e-06
ependymoma -2.500 1.5e-02
facioscapulohumeral dystrophy 2.000 1.3e-02
gastric cancer 1.400 4.7e-04
glioblastoma -1.700 6.7e-04
group 3 medulloblastoma -1.200 7.3e-03
hepatocellular carcinoma 1.500 3.8e-06
interstitial cystitis 1.300 2.9e-02
intraductal papillary-mucinous adenoma (... -1.400 4.4e-05
intraductal papillary-mucinous carcinoma... -1.700 3.5e-06
intraductal papillary-mucinous neoplasm ... -1.700 2.6e-04
lung carcinoma 2.300 8.7e-40
medulloblastoma, large-cell -3.100 1.1e-04
osteosarcoma -3.291 1.4e-08
tuberculosis -1.500 1.4e-04

Gene RIF (12)

AA Sequence

MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQER      1 - 70
FRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEK     71 - 140
LAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERR    141 - 210
CLC                                                                       211 - 213
//

Text Mined References (31)

PMID Year Title