Property Summary

NCBI Gene PubMed Count 33
PubMed Score 223.66
PubTator Score 22.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 1.626 3.0e-02
active ulcerative colitis 2.459 4.6e-03
adrenocortical carcinoma 1.279 3.5e-02
Atopic dermatitis 1.800 1.6e-03
breast carcinoma 1.300 2.0e-03
chronic rhinosinusitis 3.389 2.6e-03
cystic fibrosis 1.100 5.9e-03
ductal carcinoma in situ 2.400 3.9e-02
fibroadenoma 2.900 4.3e-03
interstitial cystitis -1.400 3.4e-02
intraductal papillary-mucinous adenoma (... 2.200 4.2e-04
intraductal papillary-mucinous carcinoma... 2.200 7.6e-03
intraductal papillary-mucinous neoplasm ... 3.500 4.5e-04
invasive ductal carcinoma 2.400 5.4e-03
lung cancer -2.700 2.3e-02
osteosarcoma -2.297 8.1e-09
pancreatic cancer 2.400 9.7e-08
pancreatic ductal adenocarcinoma liver m... 1.142 2.3e-02
psoriasis -1.100 2.0e-03

Synonym

Accession Q96DA0 A6NIY1 B2R4F6 Q6UW28
Symbols EECP
PAUF
JCLN2
HRPE773
PRO1567

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Gene RIF (18)

AA Sequence

MGAQGAQESIKAMWRVPGTTRRPVTGESPGMHRPEAMLLLLTLALLGGPTWAGKMYGPGGGKYFSTTEDY      1 - 70
DHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKD     71 - 140
RYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR      141 - 208
//

Text Mined References (35)

PMID Year Title