Property Summary

NCBI Gene PubMed Count 29
Grant Count 9
R01 Count 3
Funding $1,486,327
PubMed Score 222.79
PubTator Score 22.38

Knowledge Summary

Patent

No data available

Expression

Gene RIF (14)

PMID Text
26336989 PAUF mediated dendritic cell activation and immune stimulation are dependent on TLR4
25727013 constitutive suppression of PAUF sensitized Bxpc3 pancreatic cancer cells to oncolytic parvovirus H-1 infection
25079514 PAUF rs12373A>C polymorphisms are associated with colorectal cancer.
23677445 PAUF-siRNA inhibited the proliferation of colorectal cancer cells, promoted their apoptosis and induced G0/G1 cell cycle arrest. At the same time, PAUF-siRNA inhibited the invasion, adhesion and migration of the tumor cells.
22907431 new possibilities for PAUF's role in the pathogenesis of angiogenesis-dependent diseases
22640743 activation of SIRT1 inhibited the proliferation of pancreatic cancer -PAUF cells by down-regulation of cyclin-D1, a target molecule of beta-catenin.
21464589 PAUF-mediated FAK activation plays an important role in pancreatic cancer progression.
21196815 PAUF can up-regulate and stabilize beta-catenin via a novel pattern of phosphorylation, thereby contributing to the rapid proliferation of pancreatic cancer cells.
21110947 the sugar-binding site and the adjacent basic patch of ZG16p and ZG16b cooperatively form a functional glycosaminoglycan-binding site.
20858015 Data demonstrate that the host salivary protein CSP-1 (HRPE773 GenBank AAQ89380.1) binds to S. mutans cells and may influence the initial colonization of this pathogenic bacterium onto the tooth surface.
More...

AA Sequence

MGAQGAQESIKAMWRVPGTTRRPVTGESPGMHRPEAMLLLLTLALLGGPTWAGKMYGPGGGKYFSTTEDY      1 - 70
DHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKD     71 - 140
RYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR      141 - 208
//

Text Mined References (31)

PMID Year Title
26336989 2015 Pancreatic adenocarcinoma upregulated factor serves as adjuvant by activating dendritic cells through stimulation of TLR4.
25727013 2015 Pancreatic adenocarcinoma upregulated factor (PAUF) confers resistance to pancreatic cancer cells against oncolytic parvovirus H-1 infection through IFNA receptor-mediated signaling.
25079514 2015 Genetic variation in microRNA-binding site and prognosis of patients with colorectal cancer.
23677445 2013 Silencing of pancreatic adenocarcinoma upregulated factor by RNA interference inhibits the malignant phenotypes of human colorectal cancer cells.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22907431 2013 Pancreatic adenocarcinoma upregulated factor, a novel endothelial activator, promotes angiogenesis and vascular permeability.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22640743 2012 SIRT1 inhibits proliferation of pancreatic cancer cells expressing pancreatic adenocarcinoma up-regulated factor (PAUF), a novel oncogene, by suppression of ?-catenin.
More...