Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.46
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -2.200 0.016
oligodendroglioma -1.900 0.033
glioblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -2.400 0.000
pediatric high grade glioma -1.200 0.001
pilocytic astrocytoma -1.200 0.000
subependymal giant cell astrocytoma -2.257 0.001

Gene RIF (1)

PMID Text
15970276 EID-3 inhibits MyoD- and GRα-dependent transcription and blocked muscle differentiation in cultured cells. It also associates with class I HDACs.

AA Sequence

MAEPTGLLEMSELPGDSSVPQVGTASGVSDVLRGAVGGGVRVQEAREGPVAEAARSMARMPGPVPGPIPS      1 - 70
SVPGLASAPDPHQQLAFLEINRQLLFREYLDGSSMIPVRLLRDFEERRRLFVEGCKAREAAFDADPPQMD     71 - 140
FAAVAFTVALTASEALSPLAD                                                     141 - 161
//

Text Mined References (4)

PMID Year Title
15970276 2005 A novel EID family member, EID-3, inhibits differentiation and forms a homodimer or heterodimer with EID-2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.