Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.46
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.100 1.4e-02
astrocytic glioma -2.200 1.6e-02
Astrocytoma, Pilocytic -1.200 5.7e-04
atypical teratoid / rhabdoid tumor -1.600 1.5e-04
glioblastoma -1.800 3.1e-04
medulloblastoma, large-cell -2.400 2.0e-04
oligodendroglioma -1.900 3.3e-02
subependymal giant cell astrocytoma -2.257 6.6e-04

Gene RIF (1)

AA Sequence

MAEPTGLLEMSELPGDSSVPQVGTASGVSDVLRGAVGGGVRVQEAREGPVAEAARSMARMPGPVPGPIPS      1 - 70
SVPGLASAPDPHQQLAFLEINRQLLFREYLDGSSMIPVRLLRDFEERRRLFVEGCKAREAAFDADPPQMD     71 - 140
FAAVAFTVALTASEALSPLAD                                                     141 - 161
//

Text Mined References (4)

PMID Year Title