Property Summary

NCBI Gene PubMed Count 41
Grant Count 67
R01 Count 45
Funding $23,341,721.4
PubMed Score 446.69
PubTator Score 228.48

Knowledge Summary

Patent (12,881)

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.208 0.001
primary Sjogren syndrome 1.200 0.009

Synonym

Accession Q96D96 A8MQ37 B4DEB3 F8WCH5 Q6UW11 Q96IS5
Symbols HV1
VSOP

Gene

PDB

3A2A  

Gene RIF (32)

PMID Text
26559003 Our data demonstrated that the expression of Hv1 in pancreatic islet beta-cells regulates insulin secretion through regulating Ca(2+) homeostasis.
26458876 Trp207 is crucial for slow channel opening, highly temperature-dependent gating kinetics, proton selectivity, and DeltapH-dependent gating.
25964989 The main properties of the voltage-gated proton channel (HV1) are described in this review, along with what is known about how the channel protein structure accomplishes its functions. [review]
25446125 analysis of of the C-terminal domain of voltage-gated proton channel HV1 and the thermodynamic characteristics of Zn(2) binding to this domain
25425665 A shorter isoform of HVCN1 with enhanced gating is specifically enriched in malignant B cells.
25296308 Hv1 activity displays hysteresis
24867409 Divalent metal binding causes a conformational change in human the Hv1 c-terminal domain.
24379371 Salt bridge networks and the hydrophobic plug function as the gate in Hv1 channels; outward movement of the fourth transmembrane segment leads to the opening of this gate.
23940591 Results suggest that Hv1 may be used as a potential biomarker for diagnosis and prognosis of colorectal carcinoma, and a potential target for anticancer drugs in colorectal cancer therapy.
23891691 inhibition of Hv1 activity via Zn(2+) ions can effectively retard the cancer growth and suppress the cancer metastasis by the decrease of proton extrusion and the down-regulation of gelatinase activity
More...

AA Sequence

MATWDEKAVTRRAKVAPAERMSKFLRHFTVVGDDYHAWNINYKKWENEEEEEEEEQPPPTPVSGEEGRAA      1 - 70
APDVAPAPGPAPRAPLDFRGMLRKLFSSHRFQVIIICLVVLDALLVLAELILDLKIIQPDKNNYAAMVFH     71 - 140
YMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVA    141 - 210
RIINGIIISVKTRSERQLLRLKQMNVQLAAKIQHLEFSCSEKEQEIERLNKLLRQHGLLGEVN           211 - 273
//

Text Mined References (44)

PMID Year Title
26559003 2015 The voltage-gated proton channel Hv1 is expressed in pancreatic islet ?-cells and regulates insulin secretion.
26458876 2015 Tryptophan 207 is crucial to the unique properties of the human voltage-gated proton channel, hHV1.
25964989 2015 The Voltage-Gated Proton Channel: A Riddle, Wrapped in a Mystery, inside an Enigma.
25446125 2015 The pH-sensitive structure of the C-terminal domain of voltage-gated proton channel and the thermodynamic characteristics of Zn²? binding to this domain.
25425665 2014 Enhanced activation of an amino-terminally truncated isoform of the voltage-gated proton channel HVCN1 enriched in malignant B cells.
25296308 2014 Hv1 proton channel opening is preceded by a voltage-independent transition.
24867409 2014 Interaction of divalent metal ions with the carboxyl-terminal domain of human voltage-gated proton channel Hv1.
24379371 2014 Hydrophobic plug functions as a gate in voltage-gated proton channels.
23940591 2013 Human voltage-gated proton channel hv1: a new potential biomarker for diagnosis and prognosis of colorectal cancer.
23891691 2013 Zn(2+) induces apoptosis in human highly metastatic SHG-44 glioma cells, through inhibiting activity of the voltage-gated proton channel Hv1.
More...