Property Summary

Ligand Count 1
NCBI Gene PubMed Count 45
PubMed Score 486.11
PubTator Score 228.48

Knowledge Summary

Patent (12,881)

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.1e-03
primary Sjogren syndrome 735 8.9e-03
Disease Target Count Z-score Confidence
Herpes simplex 18 3.445 1.7
Retinitis 7 3.165 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.208 1.1e-03
primary Sjogren syndrome 1.200 8.9e-03

Gene RIF (36)

AA Sequence

MATWDEKAVTRRAKVAPAERMSKFLRHFTVVGDDYHAWNINYKKWENEEEEEEEEQPPPTPVSGEEGRAA      1 - 70
APDVAPAPGPAPRAPLDFRGMLRKLFSSHRFQVIIICLVVLDALLVLAELILDLKIIQPDKNNYAAMVFH     71 - 140
YMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVA    141 - 210
RIINGIIISVKTRSERQLLRLKQMNVQLAAKIQHLEFSCSEKEQEIERLNKLLRQHGLLGEVN           211 - 273
//

Text Mined References (48)

PMID Year Title