Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.97
PubTator Score 0.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 7.05896374678344E-6
Breast cancer 3099 4.07305658482036E-5
pancreatic cancer 2300 5.23661578894164E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 4.55800293177154E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00134440987804914
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00352311248544535
active Crohn's disease 918 0.00493969199079029
active ulcerative colitis 477 0.00943188315302923
Endometriosis 535 0.0220750355788004

Expression

Synonym

Accession Q96D59
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum EggNOG Inparanoid
Xenopus OMA EggNOG

AA Sequence

MAEQQGRELEAECPVCWNPFNNTFHTPKMLDCCHSFCVECLAHLSLVTPARRRLLCPLCRQPTVLASGQP      1 - 70
VTDLPTDTAMLALLRLEPHHVILEGHQLCLKDQPKSRYFLRQPQVYTLDLGPQPGGQTGPPPDTASATVS     71 - 140
TPILIPSHHSLRECFRNPQFRIFAYLMAVILSVTLLLIFSIFWTKQFLWGVG                      141 - 192
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.