Property Summary

Ligand Count 1
NCBI Gene PubMed Count 12
PubMed Score 17.95
PubTator Score 2.38

Knowledge Summary

Patent (1,034)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
NEPHROTIC SYNDROME, TYPE 9 1 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 1.3e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.138 1.3e-04

Gene RIF (2)

AA Sequence

MWLKVGGLLRGTGGQLGQTVGWPCGALGPGPHRWGPCGGSWAQKFYQDGPGRGLGEEDIRRAREARPRKT      1 - 70
PRPQLSDRSRERKVPASRISRLANFGGLAVGLGLGVLAEMAKKSMPGGRLQSEGGSGLDSSPFLSEANAE     71 - 140
RIVQTLCTVRGAALKVGQMLSIQDNSFISPQLQHIFERVRQSADFMPRWQMLRVLEEELGRDWQAKVASL    141 - 210
EEVPFAAASIGQVHQGLLRDGTEVAVKIQYPGIAQSIQSDVQNLLAVLKMSAALPAGLFAEQSLQALQQE    211 - 280
LAWECDYRREAACAQNFRQLLANDPFFRVPAVVKELCTTRVLGMELAGGVPLDQCQGLSQDLRNQICFQL    281 - 350
LTLCLRELFEFRFMQTDPNWANFLYDASSHQVTLLDFGASREFGTEFTDHYIEVVKAAADGDRDCVLQKS    351 - 420
RDLKFLTGFETKAFSDAHVEAVMILGEPFATQGPYDFGSGETARRIQDLIPVLLRHRLCPPPEETYALHR    421 - 490
KLAGAFLACAHLRAHIACRDLFQDTYHRYWASRQPDAATAGSLPTKGDSWVDPS                    491 - 544
//

Text Mined References (17)

PMID Year Title