Property Summary

NCBI Gene PubMed Count 11
PubMed Score 26.75
PubTator Score 7.10

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
lung adenocarcinoma 1.100 2.5e-05
non-small cell lung cancer 1.046 1.1e-13
osteosarcoma 3.204 3.5e-06
sonic hedgehog group medulloblastoma 1.300 7.7e-03
tuberculosis and treatment for 6 months 1.500 2.9e-05

Gene RIF (2)

AA Sequence

MEYMAESTDRSPGHILCCECGVPISPNPANICVACLRSKVDISQGIPKQVSISFCKQCQRYFQPPGTWIQ      1 - 70
CALESRELLALCLKKIKAPLSKVRLVDAGFVWTEPHSKRLKVKLTIQKEVMNGAILQQVFVVDYVVQSQM     71 - 140
CGDCHRVEAKDFWKAVIQVRQKTLHKKTFYYLEQLILKYGMHQNTLRIKEIHDGLDFYYSSKQHAQKMVE    141 - 210
FLQCTVPCRYKASQRLISQDIHSNTYNYKSTFSVEIVPICKDNVVCLSPKLAQSLGNMNQICVCIRVTSA    211 - 280
IHLIDPNTLQVADIDGSTFWSHPFNSLCHPKQLEEFIVMECSIVQDIKRAAGAGMISKKHTLGEVWVQKT    281 - 350
SEMNTDKQYFCRTHLGHLLNPGDLVLGFDLANCNLNDEHVNKMNSDRVPDVVLIKKSYDRTKRQRRRNWK    351 - 420
LKELARERENMDTDDERQYQDFLEDLEEDEAIRKNVNIYRDSAIPVESDTDDEGAPRISLAEMLEDLHIS    421 - 490
QDATGEEGASMLT                                                             491 - 503
//

Text Mined References (21)

PMID Year Title