Property Summary

NCBI Gene PubMed Count 153
Grant Count 159
R01 Count 52
Funding $12,193,947.13
PubMed Score 404.41
PubTator Score 381.77

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96D42 O43656 HAVcr-1
Symbols TIM
KIM1
TIM1
CD365
HAVCR
KIM-1
TIM-1
TIMD1
TIMD-1
HAVCR-1

Gene

PDB

5DZO   5F70  

Gene RIF (150)

PMID Text
27295912 Urinary KIM1 is significantly higher in patients with clear cell renal carcinoma than in controls. Urinary KIM1 decreases after nephrectomy in clear cell renal carcinoma patients.
27049082 decreased serum TIM-1 and TIM-3 levels and association of TIM-3 with nephritis suggest their possible role in the development and pathogenesis of systemic lupus erythematosus.
26921445 Activation of TIM1 by exposing the cells to TIM4 significantly increased the frequency of apoptotic colon cancer cells. The expression of FasL was increased in the cancer cells after treating by TIM4.
26751954 Urinary VDBP and KIM-1 are potent new biomarkers of major adverse renal events in patients undergoing coronary angiography.
26697493 The aim of this review article is to summarize the literature data concerning KIM-1 as a potential novel marker in the early diagnosis and prediction of clinical outcome of certain cardiovascular diseases.
26673824 Data show that kidney injury molecule (KIM)-1 and neutrophil gelatinase-associated lipocalin (NGAL), were significantly elevated in welding workers post-exposure.
26575624 Phosphatidylethanolamine plays a key role in TIM1-mediated virus entry.
26407192 Urine KIM1 level was higher in kidney stone patients before lithotripsy than in healthy controls.
26393328 High NGAL and KIM-1 levels may indicate early diabetic kidney injury; however, we did not observe any relationship between these markers and diabetic indices
26332704 TIM-1 ligands increase the amount of cell surface protein, preventing its traffic to the immune synapse
More...

AA Sequence

MHPQVVILSLILHLADSVAGSVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVT      1 - 70
YRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSLEIVPPKVTTTPIVTTVPT     71 - 140
VTTVRTSTTVPTTTTVPTTTVPTTMSIPTTTTVLTTMTVSTTTSVPTTTSIPTTTSVPVTTTVSTFVPPM    141 - 210
PLPRQNHEPVATSPSSPQPAETHPTTLQGAIRREPTSSPLYSYTTDGNDTVTESSDGLWNNNQTQLFLEH    211 - 280
SLLTANTTKGIYAGVCISVLVLLALLGVIIAKKYFFKKEVQQLSVSFSSLQIKALQNAVEKEVQAEDNIY    281 - 350
IENSLYATD                                                                 351 - 359
//

Text Mined References (157)

PMID Year Title
27295912 2016 Urinary KIM-1 and AQP-1 in patients with clear renal cell carcinoma: Potential noninvasive biomarkers.
27049082 Decreased serum levels of T-cell immunoglobulin mucin-1 and T-cell immunoglobulin mucin-3 in systemic lupus erythematosus patients.
26921445 2016 Activation of TIM1 induces colon cancer cell apoptosis via modulating Fas ligand expression.
26751954 2016 Urinary Vitamin D Binding Protein and KIM-1 Are Potent New Biomarkers of Major Adverse Renal Events in Patients Undergoing Coronary Angiography.
26697493 2015 Kidney Injury Molecule-1 and Cardiovascular Diseases: From Basic Science to Clinical Practice.
26673824 2015 Urinary neutrophil gelatinase-associated lipocalin is associated with heavy metal exposure in welding workers.
26575624 2015 Virion-associated phosphatidylethanolamine promotes TIM1-mediated infection by Ebola, dengue, and West Nile viruses.
26407192 2016 The Application of Kidney Injury Molecule-1 to Determine the Duration Between Shockwave Lithotripsy Sessions.
26393328 2016 Kidney injury molecule-1 and neutrophil gelatinase associated lipocalin in normoalbuminuric diabetic children.
26332704 2015 Distinct Trafficking of Cell Surface and Endosomal TIM-1 to the Immune Synapse.
More...