Property Summary

NCBI Gene PubMed Count 176
PubMed Score 438.10
PubTator Score 381.77

Knowledge Summary

Patent

No data available

Expression

Gene RIF (168)

AA Sequence

MHPQVVILSLILHLADSVAGSVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVT      1 - 70
YRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSLEIVPPKVTTTPIVTTVPT     71 - 140
VTTVRTSTTVPTTTTVPTTTVPTTMSIPTTTTVLTTMTVSTTTSVPTTTSIPTTTSVPVTTTVSTFVPPM    141 - 210
PLPRQNHEPVATSPSSPQPAETHPTTLQGAIRREPTSSPLYSYTTDGNDTVTESSDGLWNNNQTQLFLEH    211 - 280
SLLTANTTKGIYAGVCISVLVLLALLGVIIAKKYFFKKEVQQLSVSFSSLQIKALQNAVEKEVQAEDNIY    281 - 350
IENSLYATD                                                                 351 - 359
//

Text Mined References (180)

PMID Year Title