Property Summary

Ligand Count 12
NCBI Gene PubMed Count 255
PubMed Score 389.65
PubTator Score 352.88

Knowledge Summary

Patent (7,315)

Expression

  Differential Expression (2)

Disease log2 FC p
acute quadriplegic myopathy -1.063 7.3e-08
glioblastoma 1.300 2.3e-05

Gene RIF (241)

AA Sequence

MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSYSEVMSLNEHS      1 - 70
MQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDADHDYPPGLLIAFSACTTVLVAVHLFALMI     71 - 140
STCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTVIGTLLFLAEVVLLCWVKFLPLKKQPGQPR    141 - 210
PTSKPPASGAAANVSTSGITPGQAAAIASTTIMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNELAEFA    211 - 280
RLQDQLDHRGDHPLTPGSHYA                                                     281 - 301
//

Text Mined References (259)

PMID Year Title