Property Summary

NCBI Gene PubMed Count 217
Grant Count 223
R01 Count 140
Funding $24,862,220.81
PubMed Score 345.31
PubTator Score 352.88

Knowledge Summary

Patent (7,315)

Synonym

Accession Q96D31 Q3MHV3 Q6DHX2 Q96BP7 Q96K71
Symbols IMD9
TAM2
ORAT1
CRACM1
TMEM142A

Gene

PDB

2MAK   4EHQ  

Gene RIF (207)

PMID Text
27069021 Sigma1 receptors attenuates STIM1 coupling to Orai1 and thereby inhibits SOCE.
26916730 Orai1-dependent Ca(2+) entry promotes atherogenesis possibly by promoting foam cell formation and vascular inflammation, rendering orai1 Ca(2+) channel a potential therapeutic target against atherosclerosis.
26826124 T Cell Receptor-induced Nuclear Factor kappaB (NF-kappaB) Signaling and Transcriptional Activation Are Regulated by STIM1- and Orai1-mediated Calcium Entry.
26817842 SARAF is constitutively expressed in the plasma membrane and interacts with Orai1.
26814231 Orai1 senses the amount of cholesterol in the plasma membrane and the interaction of Orai1 with cholesterol inhibits its activity, thereby limiting store-operated Ca(2+) entry
26809794 STIM11-469 and Orai1 W76A mutants do not reduce channel open probability.
26809793 The crystal structure of Ca(2+)-CaM bound to an Orai1 N-terminal peptide.
26789410 Results identified common non-synonymous single nucleotide polymorphism located within exon 2 and a rare 6 base-pair in-frame insertion variant in ORAI1 gene associated with Kawasaki disease.
26712003 These first recordings of single-channel Orai1 currents reveal unexpected dynamics, and when paired with CRAC-activating domain association, support multiple single-channel states.
26665756 These results indicate that genetic factors, in particular polymorphic variants of the ORAI calcium release-activated calcium modulator 1 (ORAI1, rs7135617), may affect multiple kidney stone formation in the Russian population.
More...

AA Sequence

MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSYSEVMSLNEHS      1 - 70
MQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDADHDYPPGLLIAFSACTTVLVAVHLFALMI     71 - 140
STCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTVIGTLLFLAEVVLLCWVKFLPLKKQPGQPR    141 - 210
PTSKPPASGAAANVSTSGITPGQAAAIASTTIMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNELAEFA    211 - 280
RLQDQLDHRGDHPLTPGSHYA                                                     281 - 301
//

Text Mined References (221)

PMID Year Title
27069021 2016 Sigma1 receptors inhibit store-operated Ca2+ entry by attenuating coupling of STIM1 to Orai1.
26916730 2016 Inhibition of Orai1 Store-Operated Calcium Channel Prevents Foam Cell Formation and Atherosclerosis.
26826124 2016 T Cell Receptor-induced Nuclear Factor ?B (NF-?B) Signaling and Transcriptional Activation Are Regulated by STIM1- and Orai1-mediated Calcium Entry.
26817842 2016 Store-operated Ca2+ Entry-associated Regulatory factor (SARAF) Plays an Important Role in the Regulation of Arachidonate-regulated Ca2+ (ARC) Channels.
26814231 2016 Cholesterol modulates Orai1 channel function.
26809794 2016 The inactivation domain of STIM1 is functionally coupled with the Orai1 pore to enable Ca2+-dependent inactivation.
26809793 2016 Orai1 pore residues control CRAC channel inactivation independently of calmodulin.
26789410 2016 Variations in ORAI1 Gene Associated with Kawasaki Disease.
26712003 2016 Genetically targeted single-channel optical recording reveals multiple Orai1 gating states and oscillations in calcium influx.
26665756 [GENETIC RISK FACTORS FOR MULTIPLE KIDNEY STONE FORMATION IN THE RUSSIAN POPULATION].
More...