Property Summary

NCBI Gene PubMed Count 22
Grant Count 25
R01 Count 6
Funding $2,190,745.24
PubMed Score 163.68
PubTator Score 54.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.400 0.001
posterior fossa group B ependymoma -2.200 0.000
glioblastoma -1.800 0.000
oligodendroglioma -1.200 0.000
group 3 medulloblastoma -2.000 0.028
medulloblastoma, large-cell -2.100 0.001
primitive neuroectodermal tumor -1.200 0.019
adult high grade glioma -2.000 0.003
atypical teratoid/rhabdoid tumor -1.200 0.041
pilocytic astrocytoma -1.600 0.001
lung carcinoma 1.700 0.000

Gene RIF (13)

PMID Text
26228524 Study demonstrated that variation in the gene coding for RASD2 (rs6518956) affects in vivo prefrontal and striatal phenotypes in healthy human subjects that are relevant to schizophrenia
26190541 Rhes influences striatal cAMP/PKA-dependent signaling and synaptic plasticity in a gender-sensitive fashion
25818655 Findings reveal that ras homolog enriched in striatum is localized also in striatal cholinergic interneurons and, most importantly, lack of this G-protein, significantly alters dopamine D2 receptor modulation of striatal cholinergic excitability.
25556834 Rhes is reduced in the brains of Huntington's disease patients.
24324270 Rhes robustly binds the autophagy regulator Beclin-1, decreasing its inhibitory interaction with Bcl-2 independent of JNK-1 signaling.
23999124 The findings of this study suggested that Rhes may play a crucial role in striatal iron homeostasis.
23583659 The sequestering of Rhes through its binding to mutant huntingtin may decrease the ability of Rhes to perform vital physiological functions in the striatum neurons of Huntington disease patients. (Review)
19255495 Binding to the Gbeta subunits involves the cationic regions of AGS1 and Rhes, and Data used Rhes-AGS1 chimeras to show that their different cationic regions determine the Gbeta-specificity of the interactions.
18815223 The monomeric G proteins AGS1 and Rhes selectively influence Galphai-dependent signaling to modulate N-type (CaV2.2) calcium channels.
18571626 The genes RASD2 might be vulnerability genes for neuropsychologically defined subgroups of schizophrenic patients.
More...

AA Sequence

MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLD      1 - 70
ILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGN     71 - 140
KNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGD    141 - 210
AFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCTIQ                  211 - 266
//

Text Mined References (23)

PMID Year Title
26228524 2016 Rasd2 Modulates Prefronto-Striatal Phenotypes in Humans and 'Schizophrenia-Like Behaviors' in Mice.
26190541 2015 Rhes influences striatal cAMP/PKA-dependent signaling and synaptic plasticity in a gender-sensitive fashion.
25818655 2015 Rhes regulates dopamine D2 receptor transmission in striatal cholinergic interneurons.
25556834 2015 Reinstating aberrant mTORC1 activity in Huntington's disease mice improves disease phenotypes.
24324270 2014 Rhes, a striatal-selective protein implicated in Huntington disease, binds beclin-1 and activates autophagy.
23999124 2013 PKA modulates iron trafficking in the striatum via small GTPase, Rhes.
23583659 2013 The role of Rhes, Ras homolog enriched in striatum, in neurodegenerative processes.
19498170 2009 Rhes, a striatal specific protein, mediates mutant-huntingtin cytotoxicity.
19255495 2009 The cationic region of Rhes mediates its interactions with specific Gbeta subunits.
18815223 2008 The monomeric G proteins AGS1 and Rhes selectively influence Galphai-dependent signaling to modulate N-type (CaV2.2) calcium channels.
More...