Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.52
PubTator Score 1.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession Q96D15 Q9HBZ8
Symbols RLP49

Gene

Gene RIF (2)

PMID Text
27468573 RCN3 expression in systemic sclerosis was not statistically significantly different to healthy controls.
16433634 Autoactivation & secretion of rat PACE4 was increased upon co-expression with recombinant human RCN-3. Selective and transient association of RCN-3 with the precursor of PACE4 plays an important role in the biosynthesis of PACE4.

AA Sequence

MMWRPSVLLLLLLLRHGAQGKPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQ      1 - 70
LTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRN     71 - 140
ATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLE    141 - 210
DLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLV    211 - 280
EANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL                          281 - 328
//

Text Mined References (12)

PMID Year Title
27468573 2016 Circulating Reticulocalbin 1 and Reticulocalbin 3 in Systemic Sclerosis Patients: Results of a Case Control Study.
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
21269460 2011 Initial characterization of the human central proteome.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
16433634 2006 A proteomic approach reveals transient association of reticulocalbin-3, a novel member of the CREC family, with the precursor of subtilisin-like proprotein convertase, PACE4.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...