Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.70
PubTator Score 2.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -2.200 0.004
ependymoma -3.000 0.008
oligodendroglioma -1.600 0.026
glioblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -1.900 0.000
intraductal papillary-mucinous carcinoma... -1.700 0.000
intraductal papillary-mucinous neoplasm ... -1.800 0.001
interstitial cystitis -1.100 0.001
adult high grade glioma -1.500 0.000
subependymal giant cell astrocytoma -1.621 0.011
invasive ductal carcinoma -1.400 0.005
Breast cancer -1.700 0.000
lung carcinoma 1.900 0.000
breast carcinoma -1.200 0.000
Pick disease -1.400 0.015
ovarian cancer -3.500 0.000

Gene RIF (2)

PMID Text
20479760 Observational study of gene-disease association. (HuGE Navigator)
16835690 that huntingtin protein and GASP2 form a complex in cotransfected mammalian cells

AA Sequence

MTGAEIEPSAQAKPEKKAGEEVIAGPERENDVPLVVRPKVRTQATTGARPKTETKSVPAARPKTEAQAMS      1 - 70
GARPKTEVQVMGGARPKTEAQGITGARPKTDARAVGGARSKTDAKAIPGARPKDEAQAWAQSEFGTEAVS     71 - 140
QAEGVSQTNAVAWPLATAESGSVTKSKGLSMDRELVNVDAETFPGTQGQKGIQPWFGPGEETNMGSWCYS    141 - 210
RPRAREEASNESGFWSADETSTASSFWTGEETSVRSWPREESNTRSRHRAKHQTNPRSRPRSKQEAYVDS    211 - 280
WSGSEDEASNPFSFWVGENTNNLFRPRVREEANIRSKLRTNREDCFESESEDEFYKQSWVLPGEEANSRF    281 - 350
RHRDKEDPNTALKLRAQKDVDSDRVKQEPRFEEEVIIGSWFWAEKEASLEGGASAICESEPGTEEGAIGG    351 - 420
SAYWAEEKSSLGAVAREEAKPESEEEAIFGSWFWDRDEACFDLNPCPVYKVSDRFRDAAEELNASSRPQT    421 - 490
WDEVTVEFKPGLFHGVGFRSTSPFGIPEEASEMLEAKPKNLELSPEGEEQESLLQPDQPSPEFTFQYDPS    491 - 560
YRSVREIREHLRARESAESESWSCSCIQCELKIGSEEFEEFLLLMDKIRDPFIHEISKIAMGMRSASQFT    561 - 630
RDFIRDSGVVSLIETLLNYPSSRVRTSFLENMIHMAPPYPNLNMIETFICQVCEETLAHSVDSLEQLTGI    631 - 700
RMLRHLTMTIDYHTLIANYMSGFLSLLTTANARTKFHVLKMLLNLSENPAVAKKLFSAKALSIFVGLFNI    701 - 770
EETNDNIQIVIKMFQNISNIIKSGKMSLIDDDFSLEPLISAFREFEELAKQLQAQIDNQNDPEVGQQS      771 - 838
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
20479760 2011 Systematic resequencing of X-chromosome synaptic genes in autism spectrum disorder and schizophrenia.
16835690 2006 Huntingtin interacts with the receptor sorting family protein GASP2.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16221301 2005 Mammalian BEX, WEX and GASP genes: coding and non-coding chimaerism sustained by gene conversion events.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
More...