Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.05
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.600 7.9e-05
astrocytic glioma -2.000 2.7e-03
Astrocytoma, Pilocytic -2.100 6.5e-09
atypical teratoid / rhabdoid tumor -1.100 1.0e-03
ependymoma -2.000 5.8e-03
glioblastoma -1.400 6.3e-08
medulloblastoma, large-cell -1.700 1.3e-03
oligodendroglioma -2.200 6.2e-03
subependymal giant cell astrocytoma -1.572 2.4e-02

Gene RIF (2)

AA Sequence

MVRILANGEIVQDDDPRVRTTTQPPRGSIPRQSFFNRGHGAPPGGPGPRQQQAGARLGAAQSPFNDLNRQ      1 - 70
LVNMGFPQWHLGNHAVEPVTSILLLFLLMMLGVRGLLLVGLVYLVSHLSQR                        71 - 121
//

Text Mined References (12)

PMID Year Title